![Immunocytochemistry/Immunofluorescence: VAMP4 Antibody [NBP2-13512] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/VAMP4-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13512-img0005.jpg "Immunocytochemistry/Immunofluorescence: VAMP4 Antibody [NBP2-13512] - Staining of human cell line A-431 shows localization to the Golgi apparatus. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: MPPKFKRHLNDDDVTGSVKSERRNLLEDDSDEEEDFFLRGPSGPRFGPRNDK |
| Marker | Vesicle Marker, Golgi Apparatus Marker |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | VAMP4 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Simple_Western_20944.jpg)
![Western Blot Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Western_Blot_5806.jpg)
![Immunohistochemistry Syntaxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Syntaxin_5_AF5687_Immunohistochemistry_19570.jpg)
| Publication using NBP2-13512 | Applications | Species |
|---|---|---|
| Gu Y, Princely Y, Kumar S et al. Mammalian Atg8 proteins regulate lysosome and autolysosome biogenesis through SNAREs. EMBO J. 2019-10-18 [PMID: 31625181] |
Secondary Antibodies |
Isotype Controls |
Research Areas for VAMP4 Antibody (NBP2-13512)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | VAMP4 |
![Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/VAMP4-Antibody-Immunohistochemistry-Paraffin-NBP2-13512-img0012.jpg "Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human cerebral cortex shows strong granular cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells](http://images.novusbio.com/fullsize/VAMP4-Antibody-Immunohistochemistry-Paraffin-NBP2-13512-img0008.jpg "Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human endometrium shows moderate granular cytoplasmic positivity in glandular cells")
![Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human skeletal muscle shows weak positivity in myocytes.](http://images.novusbio.com/fullsize/VAMP4-Antibody-Immunohistochemistry-Paraffin-NBP2-13512-img0009.jpg "Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human skeletal muscle shows weak positivity in myocytes.")
![Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding VAMP4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/VAMP4-Antibody-Immunohistochemistry-Paraffin-NBP2-13512-img0010.jpg "Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Analysis in human cerebral cortex and skeletal muscle tissues. Corresponding VAMP4 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/VAMP4-Antibody-Immunohistochemistry-Paraffin-NBP2-13512-img0011.jpg "Immunohistochemistry-Paraffin: VAMP4 Antibody [NBP2-13512] - Staining of human cerebellum shows moderate granular cytoplasmic positivity in Purkinje cells.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")