![Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in human cell lines U-251MG and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Western-Blot-NBP1-87334-img0021.jpg "Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in human cell lines U-251MG and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEVSPKVYFMKQTIGNSCGTIGLIHAVANNQDKLGFEDGSVLKQFLSETEKMSPEDRAKCFEKNEAIQAAHDAVAQEGQCRVDDKVNFHFILFNNVDGHLYELDGRMPFPVNHGASSEDTLLKDAAKVCREFTEREQGEVRFSAVAL |
| Marker | pan-Neuronal Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UCHL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/EN-RAGE_AF1052_Immunohistochemistry_6671.jpg)
![Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/ENRAGE_AF1052_Western_Blot_19098.jpg)
![Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1052_human-en-rage-affinity-purified-polyclonal-ab-simple-western-2672021152820.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for UCH-L1/PGP9.5 Antibody (NBP1-87334)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UCHL1 |
![Immunocytochemistry/Immunofluorescence: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87334-img0028.jpg "Immunocytochemistry/Immunofluorescence: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human cell line U-251 MG shows localization to nucleoplasm and cytosol.")
![Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining in human cerebral cortex and liver tissues . Corresponding UCHL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Immunohistochemistry-Paraffin-NBP1-87334-img0027.jpg "Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining in human cerebral cortex and liver tissues . Corresponding UCHL1 RNA-seq data are presented for the same tissues.")
![Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in mouse cerebral cortex tissue.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Western-Blot-NBP1-87334-img0017.jpg "Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in mouse cerebral cortex tissue.")
![Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Western-Blot-NBP1-87334-img0018.jpg "Western Blot: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons and in neuropil.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Immunohistochemistry-Paraffin-NBP1-87334-img0022.jpg "Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons and in neuropil.")
![Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Immunohistochemistry-Paraffin-NBP1-87334-img0023.jpg "Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human liver shows no positivity in hepatocytes, as expected.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Immunohistochemistry-Paraffin-NBP1-87334-img0024.jpg "Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human liver shows no positivity in hepatocytes, as expected.")
![Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Immunohistochemistry-Paraffin-NBP1-87334-img0025.jpg "Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human rectum shows strong cytoplasmic positivity in peripheral ganglion and peripheral nerves.](http://images.novusbio.com/fullsize/UCH-L1-PGP9.5-Antibody-Immunohistochemistry-Paraffin-NBP1-87334-img0026.jpg "Immunohistochemistry-Paraffin: UCH-L1/PGP9.5 Antibody [NBP1-87334] - Staining of human rectum shows strong cytoplasmic positivity in peripheral ganglion and peripheral nerves.")
![Immunohistochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD45_AF114_Immunohistochemistry_23525.jpg)
![Immunocytochemistry CD45 Antibody [Unconjugated]](https://images.novusbio.com/images2/af114_mouse-cd45-affinity-purified-polyclonal-ab-immunocytochemistry-6122021145449.jpg)
![Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]](https://images.novusbio.com/images/af114_mouse-cd45-affinity-purified-polyclonal-ab-41202410331954.jpg)
![Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]](https://images.novusbio.com/images2/TFF2_MAB4077_Immunohistochemistry_21485.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")