TSG101 Antibody (4T4W6) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TSG101 (Q99816). MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTG |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
TSG101 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Knockdown Validated
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for TSG101 Antibody (4T4W6)
Background
Tumor susceptibility 101 protein (human TSG101 theoretical molecular weight 44kDa) is the mammalian homologue of the yeast protein Vps23 which plays a role in endosomal and multivesicular body trafficking. TSG101 forms part of the endosomal sorting complexes required for transport complex 1 (ESCRT-I), a cytosolic multiprotein complex consisting additionally of Vps28, Vps37 (A-D) and Mvb12 (A, B) or UBAP1 (1). TSG101 contains multiple domains including the amino terminal ubiquitin e2 variant (UEV) domain, a proline-rich (RRR) domain, a coiled coil (CC) domain, and a carboxy terminal alpha-helical/steadiness box (SB) domain (2). As part of the ESCRT-I complex, TSG101 interacts through its UEV domain with ubiquitinated membrane proteins and members of the ESCRT-0 complex. The UEV domain plays a critical role for various TSG101 functions such as protein sorting into multivesicular bodies and late endosomes, and in the process of viral budding. For example, TSG101 interacts with the intermediate-conductance, Ca2+ -activated K+ channel (KCa3.1), facilitating its targeting to the lysosome for degradation (3). Additionally, TSG101 has been implicated in the turnover of connexins such as connexins 43 and 45 (4). TSG101 plays a role in other cellular functions including transcriptional regulation, cytokinesis and cell growth (2).
Upon its initial discovery, TSG101 was recognized as a tumor suppressor protein due to the identification of deletions within the TSG101 gene in human breast carcinomas. However, re-examination of the initial findings argued against this function and supported that TSG101 promotes tumorigenesis (2). In agreement with this role, TSG101 expression is upregulated in several types of cancer including breast, ovarian, and colorectal carcinoma.
References
1. Schmidt, O., & Teis, D. (2012). The ESCRT machinery. Current Biology. https://doi.org/10.1016/j.cub.2012.01.028
2. Jiang, Y., Ou, Y., & Cheng, X. (2013). Role of TSG101 in cancer. Frontiers in Bioscience. https://doi.org/10.2741/4099
3. Balut, C. M., Gao, Y., Murray, S. A., Thibodeau, P. H., & Devor, D. C. (2010). ESCRT-dependent targeting of plasma membrane localized KCa3.1 to the lysosomes. American Journal of Physiology - Cell Physiology. https://doi.org/10.1152/ajpcell.00120.2010
4. Su, V., & Lau, A. F. (2014). Connexins: Mechanisms regulating protein levels and intercellular communication. FEBS Letters. https://doi.org/10.1016/j.febslet.2014.01.013
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Ch, Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: WB, KD
Publications for TSG101 Antibody (NBP3-16608) (0)
There are no publications for TSG101 Antibody (NBP3-16608).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TSG101 Antibody (NBP3-16608) (0)
There are no reviews for TSG101 Antibody (NBP3-16608).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TSG101 Antibody (NBP3-16608) (0)