Novus Biologicals products are now on bio-techne.com

Recombinant Human Transportin 1 GST (N-Term) Protein

Name: Recombinant Human Transportin 1 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00003842-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

100% Guarantee on every product

Recombinant Human Transportin 1 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 25-141 of Human Transportin 1 Source: Wheat Germ (in vitro) Amino Acid Sequence: PDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSED
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Partial Recombinant Protein
Gene	TNPO1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	38.61 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Transportin 1 GST (N-Term) Protein

importin beta 2
Importin beta-2
IPO2
karyopherin (importin) beta 2
MIP1Karyopherin beta-2
MIPM9 region interaction protein
transportin 1
transportin-1
TRNKPNB2importin 2

Background

TNPO1 - transportin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(803 Publications)

Species: Hu

Applications: BA

CCL2/JE/MCP-1 [HRP]

DCP00

(250 Publications)

Species: Hu

Applications: ELISA

CCL5/RANTES [HRP]

DRN00B

(99 Publications)

Species: Hu

Applications: ELISA

CapG Antibody

NBP1-90214

Immunohistochemistry-Paraffin CapG Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

CD46 Antibody
[Unconjugated]

AF2005

Western Blot CD46 Antibody [Unconjugated]

(5 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, IHC, WB

Neurolysin
Antibody (OTI1D6) - A ...

NBP2-72961

Flow Cytometry Neurolysin Antibody (OTI1D6) - Azide and BSA Free

Species: Hu, Pm, Mu, Pm, Rt

Applications: CyTOF-ready, Flow, ICC/IF, IHC, WB

Cathepsin L
Antibody [Unconjugate

AF952

Immunohistochemistry Cathepsin L Antibody [Unconjugated]

(27 Publications)

Species: Hu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB

IL-10 [Biotin]

DY417

(288 Publications)

Species: Mu

Applications: ELISA

CCR5 Antibody
(45531) [Unconjugated

MAB182

Neutralization CCR5 Antibody (45531) [Unconjugated]

Immunocytochemistry CCR5 Antibody (45531) [Unconjugated]

(1 Review)

(32 Publications)

Species: Hu

Applications: CyTOF-ready, Flow, ICC, Neut

IFN-gamma
[Unconjugated]

285-IF

(2 Reviews)

(445 Publications)

Species: Hu

Applications: BA

CXCL8/IL-8
Antibody (6217) [Unco ...

MAB208

Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]

Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]

(1 Review)

(180 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB

IL-4 [Unconjugated]

6507-IL/CF

(3 Publications)

Species: Hu

Applications: BA

CXCL2/GRO
beta/MIP-2/CINC-3 [HR

MM200

(175 Publications)

Species: Mu

Applications: ELISA

Procalcitonin
Antibody (44D9)

NB120-14817

(1 Review)

(11 Publications)

Species: Hu, Rt

Applications: ICC/IF, IHC, S-ELISA, WB

PTH Antibody
(918462) [Unconjugate

MAB7665

Western Blot PTH Antibody (918462) [Unconjugated]

Species: Hu

Applications: IHC, WB

IL-2 [Unconjugated]

202-IL

(4 Reviews)

(370 Publications)

Species: Hu

Applications: BA

Publications for Transportin 1 Partial Recombinant Protein (H00003842-Q01) (0)

There are no publications for Transportin 1 Partial Recombinant Protein (H00003842-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Transportin 1 Partial Recombinant Protein (H00003842-Q01) (0)

There are no reviews for Transportin 1 Partial Recombinant Protein (H00003842-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Transportin 1 Partial Recombinant Protein (H00003842-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Transportin 1 Products

Research Areas for Transportin 1 Partial Recombinant Protein (H00003842-Q01)

Find related products by research area.

Blogs on Transportin 1.

Check out the latest blog posts on Transportin 1.

Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD)
Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm. Transportin 1 is co... Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

$Western Blot: Transportin 1 Antibody (D45) [NB600-1397] - Human lung cancer cell line usig lysates from HCC44 cell line. (N: Nuclear fraction, C: Cytoplasmic fraction). Image from verified customer review.$

Transportin 1 Antibody (D45) - BSA Free
NB600-1397

Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .

IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human Transportin 1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

TNPO1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human Transportin 1 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human Transportin 1 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human Transportin 1 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Transportin 1 Partial Recombinant Protein (H00003842-Q01) (0)

Reviews for Transportin 1 Partial Recombinant Protein (H00003842-Q01) (0)

Product General Protocols

Video Protocols

FAQs for Transportin 1 Partial Recombinant Protein (H00003842-Q01) (0)

Additional Transportin 1 Products

Research Areas for Transportin 1 Partial Recombinant Protein (H00003842-Q01)

Blogs on Transportin 1.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics