![Western Blot: TIMM8B Antibody [NBP2-94190] - Analysis of extracts of various cell lines, using TIMM8B at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.](http://images.novusbio.com/fullsize/TIMM8B-Antibody-Western-Blot-NBP2-94190-img0006.jpg "Western Blot: TIMM8B Antibody [NBP2-94190] - Analysis of extracts of various cell lines, using TIMM8B at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16-98 of human TIMM8B (NP_036591.1). MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TIMM8B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 9 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Western Blot HSP10/EPF Antibody [Unconjugated]](https://images.novusbio.com/images2/HSP10_AF2584_Western_Blot_5198.jpg)
![Simple Western HSP10/EPF Antibody [Unconjugated]](https://images.novusbio.com/images2/HSP10_AF2584_Simple_Western_17132.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TIMM8B Antibody (NBP2-94190)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TIMM8B |
![Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Rat brain using TIMM8B antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/TIMM8B-Antibody-Immunohistochemistry-Paraffin-NBP2-94190-img0005.jpg "Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Rat brain using TIMM8B antibody at dilution of 1:100 (40x lens).")
![Immunocytochemistry/Immunofluorescence: TIMM8B Antibody [NBP2-94190] - L929 cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/TIMM8B-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94190-img0001.jpg "Immunocytochemistry/Immunofluorescence: TIMM8B Antibody [NBP2-94190] - L929 cells using TIMM8B Polyclonal Antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Paraffin-embedded human breast cancer using TIMM8B .](http://images.novusbio.com/fullsize/TIMM8B-Antibody-Immunohistochemistry-Paraffin-NBP2-94190-img0003.jpg "Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Paraffin-embedded human breast cancer using TIMM8B .")
![Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Mouse heart using TIMM8B antibody at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/TIMM8B-Antibody-Immunohistochemistry-Paraffin-NBP2-94190-img0004.jpg "Immunohistochemistry-Paraffin: TIMM8B Antibody [NBP2-94190] - Mouse heart using TIMM8B antibody at dilution of 1:100 (40x lens).")
![Immunocytochemistry/ Immunofluorescence: TIMM8B Antibody - Azide and BSA Free [TIMM8B] - Immunofluorescence analysis of U-2 OS cells using TIMM8B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-94190_rabbit-polyclonal-timm8b-antibody-52202516334198.jpg "Immunocytochemistry/ Immunofluorescence: TIMM8B Antibody - Azide and BSA Free [TIMM8B] - Immunofluorescence analysis of U-2 OS cells using TIMM8B Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0001.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0003.jpg)
![Flow Cytometry Annexin V Apoptosis Kit [FITC]](https://images.novusbio.com/images/Annexin-V-Apoptosis-Kit-[FITC]-Flow-Cytometry-NBP2-29373-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")