![Immunocytochemistry/Immunofluorescence: TIMM13 Antibody [NBP2-13431] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center & mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/TIMM13-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13431-img0006.jpg "Immunocytochemistry/Immunofluorescence: TIMM13 Antibody [NBP2-13431] - Staining of human cell line HEK 293 shows localization to nucleoli fibrillar center & mitochondria. Antibody staining is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMD |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TIMM13 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TIMM13 Antibody (NBP2-13431)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TIMM13 |
![Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/TIMM13-Antibody-Immunohistochemistry-Paraffin-NBP2-13431-img0007.jpg "Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-13431_rabbit-polyclonal-timm13-antibody-immunohistochemistry-paraffin-171202491659..jpg "Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human duodenum shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/antibody/nbp2-13431_rabbit-polyclonal-timm13-antibody-immunohistochemistry-paraffin-171202491756..jpg "Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/antibody/nbp2-13431_rabbit-polyclonal-timm13-antibody-immunohistochemistry-paraffin-171202491850..jpg "Immunohistochemistry-Paraffin: TIMM13 Antibody [NBP2-13431] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images2/TIM1_AF1817_Western_Blot_17317.jpg)
![Western Blot TIM-1/KIM-1/HAVCR Antibody [Unconjugated]](https://images.novusbio.com/images/af1817_mouse-tim-1-kim-1-havcr-affinity-purified-polyclonal-ab-4120241049450.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")