Genetic Strategies: Western Blot: SDHB Antibody [NBP1-87069] - Analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SDHB antibody. Remaining relative intensity ...read more
Immunocytochemistry/ Immunofluorescence: SDHB Antibody [NBP1-87069] - Staining of human cell line PC-3 shows localization to nucleoplasm, plasma membrane & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Staining of human liver shows moderate to strong granular cytoplasmic postivity in hepatocytes.
Western Blot: SDHB Antibody [NBP1-87069] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Immunohistochemical staining of human testis shows moderate to strong granular cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Immunohistochemical staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: SDHB Antibody [NBP1-87069] - Immunohistochemical staining of human duodenum shows moderate to strong granular cytoplasmic positivity in glandular cells.
Simple Western: SDHB Antibody [NBP1-87069] - Simple Western lane view shows a specific band for SDHB in 0.2 mg/ml of RT-4 (left) and U-251MG sp (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: SDHB Antibody [NBP1-87069] - Electropherogram image(s) of corresponding Simple Western lane view. SDHB antibody was used at 1:20 dilution on RT-4 and U-251MG sp lysates(s).
This antibody was developed against Recombinant Protein corresponding to amino acids: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
Marker
Mitochondria Marker
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SDHB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Theoretical MW
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Background
Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
HIF Antibodies: Beyond HIF-1 alpha The hypoxia inducible factors are a family of heterodimeric transcription factors which are activated in response to lowered oxygen levels, or hypoxia. Although it may seem that HIF-1 alpha receives all the attention, other HIF antibodies, such as the... Read full blog post.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SDHB Antibody and receive a gift card or discount.