![Western Blot: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Analysis using Anti-DLAT antibody NBP2-34065 (A) shows similar pattern to independent antibody NBP2-56744 (B).](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E2-Antibody-Western-Blot-NBP2-34065-img0010.jpg "Western Blot: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Analysis using Anti-DLAT antibody NBP2-34065 (A) shows similar pattern to independent antibody NBP2-56744 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LLPALSPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGTPLCIIVEKEADISAFADYRPTEVTDLKPQVPPPT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DLAT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Publication using NBP2-34065 | Applications | Species |
|---|---|---|
| Kam, J H, Weinrich, T W Et al. Mitochondrial absorption of short wavelength light drives primate blue retinal cones into glycolysis which may increase their pace of aging. Vis Neurosci 2019-01-01 [PMID: 31199213] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Pyruvate Dehydrogenase E2 Antibody (NBP2-34065)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34065-img0005.jpg "Immunocytochemistry/Immunofluorescence: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Staining of human cell line U-2 OS shows positivity in mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Staining of human liver shows low expression as expected](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E2-Antibody-Immunohistochemistry-Paraffin-NBP2-34065-img0008.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Staining of human liver shows low expression as expected")
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Analysis in human heart muscle and liver tissues using Anti-DLAT antibody. Corresponding DLAT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E2-Antibody-Immunohistochemistry-Paraffin-NBP2-34065-img0006.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Analysis in human heart muscle and liver tissues using Anti-DLAT antibody. Corresponding DLAT RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Staining of human heart muscle shows high expression.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E2-Antibody-Immunohistochemistry-Paraffin-NBP2-34065-img0007.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E2 Antibody [NBP2-34065] - Staining of human heart muscle shows high expression.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/CCL27_DCC270_ELISA_54.jpg)
![N/A CCL27/CTACK [HRP]](https://images.novusbio.com/images2/DATA_CCL27_DCC270_ELISA_615.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")