![Immunocytochemistry/Immunofluorescence: TBK1 Antibody [NBP2-13416] - Staining of human cell line A-431 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/TBK1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13416-img0002.jpg "Immunocytochemistry/Immunofluorescence: TBK1 Antibody [NBP2-13416] - Staining of human cell line A-431 shows localization to nucleoplasm.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: MLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVK |
| Predicted Species | Mouse (91%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TBK1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TBK1 Antibody (NBP2-13416)Find related products by research area.
|
|
Autophagy Research Update: What a difference a year makes! By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque... Read full blog post. |
|
STING in Innate Immunity and Cancer: What’s the Buzz About? STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TBK1 |
![Immunohistochemistry-Paraffin: TBK1 Antibody [NBP2-13416] - Staining of human testis shows moderate cytoplasmic, membranous and nuclear positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/TBK1-Antibody-Immunohistochemistry-Paraffin-NBP2-13416-img0001.jpg "Immunohistochemistry-Paraffin: TBK1 Antibody [NBP2-13416] - Staining of human testis shows moderate cytoplasmic, membranous and nuclear positivity in cells in seminiferus ducts.")
![Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]](https://images.novusbio.com/images2/IKK_epsilon_MAB3199_Immunocytochemistry_10080.jpg)
![Western Blot IKK epsilon/IKBKE Antibody (346909) [Unconjugated]](https://images.novusbio.com/images2/IKK_epsilon_MAB3199_Western_Blot_6071.jpg)
![Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]](https://images.novusbio.com/images2/IKK_epsilon_MAB3199_Immunocytochemistry_9872.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Binding Activity IFN-beta [Unconjugated]](https://images.novusbio.com/images2/IFNbeta_8499IF_1038.jpg)
![Intracellular Staining by Flow Cytometry STING/TMEM173 Antibody (723505) [Unconjugated]](https://images.novusbio.com/images2/STING_MAB7169_Flow_Cytometry_16001.jpg)
![Intracellular Staining by Flow Cytometry STING/TMEM173 Antibody (723505) [Unconjugated]](https://images.novusbio.com/images2/STING_MAB7169_Flow_Cytometry_16002.jpg)
![Intracellular Staining by Flow Cytometry STING/TMEM173 Antibody (723505) [Unconjugated]](https://images.novusbio.com/images2/STING_MAB7169_Flow_Cytometry_16003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")