![Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189] - Western blot analysis of extracts of various cell lines, using TBK1 Rabbit mAb (NBP3-16189) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/TBK1-Antibody-4G6C7-Western-Blot-NBP3-16189-img0005.jpg "Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189] - Western blot analysis of extracts of various cell lines, using TBK1 Rabbit mAb (NBP3-16189) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IP |
| Clone | 4G6C7 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TBK1 (Q9UHD2). MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLFAIKVFNNISFLRPVDVQMREFEVLKKLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | TBK1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TBK1 Antibody (NBP3-16189)Find related products by research area.
|
|
Autophagy Research Update: What a difference a year makes! By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque... Read full blog post. |
|
STING in Innate Immunity and Cancer: What’s the Buzz About? STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TBK1 |
![Immunocytochemistry/Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] - Immunofluorescence analysis of U-2 OS cells using TBK1 Rabbit mAb (NBP3-16189) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/TBK1-Antibody-4G6C7-Immunocytochemistry-Immunofluorescence-NBP3-16189-img0003.jpg "Immunocytochemistry/Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] - Immunofluorescence analysis of U-2 OS cells using TBK1 Rabbit mAb (NBP3-16189) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189] - Western blot analysis of extracts of various cell lines, using TBK1 Rabbit mAb (NBP3-16189) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.](http://images.novusbio.com/fullsize/TBK1-Antibody-4G6C7-Western-Blot-NBP3-16189-img0004.jpg "Western Blot: TBK1 Antibody (4G6C7) [NBP3-16189] - Western blot analysis of extracts of various cell lines, using TBK1 Rabbit mAb (NBP3-16189) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.")
![Immunocytochemistry/Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] - Immunofluorescence analysis of C6 cells using TBK1 Rabbit mAb (NBP3-16189) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/TBK1-Antibody-4G6C7-Immunocytochemistry-Immunofluorescence-NBP3-16189-img0001.jpg "Immunocytochemistry/Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] - Immunofluorescence analysis of C6 cells using TBK1 Rabbit mAb (NBP3-16189) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] - Immunofluorescence analysis of NIH-3T3 cells using TBK1 Rabbit mAb (NBP3-16189) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/TBK1-Antibody-4G6C7-Immunocytochemistry-Immunofluorescence-NBP3-16189-img0002.jpg "Immunocytochemistry/Immunofluorescence: TBK1 Antibody (4G6C7) [NBP3-16189] - Immunofluorescence analysis of NIH-3T3 cells using TBK1 Rabbit mAb (NBP3-16189) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunoprecipitation: TBK1 Antibody (4G6C7) [NBP3-16189] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug TBK1 antibody (NBP3-16189). Western blot was performed from the immunoprecipitate using TBK1 antibody (NBP3-16189) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/TBK1-Antibody-4G6C7-Immunoprecipitation-NBP3-16189-img0006.jpg "Immunoprecipitation: TBK1 Antibody (4G6C7) [NBP3-16189] - Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug TBK1 antibody (NBP3-16189). Western blot was performed from the immunoprecipitate using TBK1 antibody (NBP3-16189) at a dilition of 1:1000.")
![Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]](https://images.novusbio.com/images2/IKK_epsilon_MAB3199_Immunocytochemistry_10080.jpg)
![Western Blot IKK epsilon/IKBKE Antibody (346909) [Unconjugated]](https://images.novusbio.com/images2/IKK_epsilon_MAB3199_Western_Blot_6071.jpg)
![Immunocytochemistry IKK epsilon/IKBKE Antibody (346909) [Unconjugated]](https://images.novusbio.com/images2/IKK_epsilon_MAB3199_Immunocytochemistry_9872.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Binding Activity IFN-beta [Unconjugated]](https://images.novusbio.com/images2/IFNbeta_8499IF_1038.jpg)
![Intracellular Staining by Flow Cytometry STING/TMEM173 Antibody (723505) [Unconjugated]](https://images.novusbio.com/images2/STING_MAB7169_Flow_Cytometry_16001.jpg)
![Intracellular Staining by Flow Cytometry STING/TMEM173 Antibody (723505) [Unconjugated]](https://images.novusbio.com/images2/STING_MAB7169_Flow_Cytometry_16002.jpg)
![Intracellular Staining by Flow Cytometry STING/TMEM173 Antibody (723505) [Unconjugated]](https://images.novusbio.com/images2/STING_MAB7169_Flow_Cytometry_16003.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")