![Western Blot: TBC1D1 Antibody [NBP1-54654] - Antibody Titration: 1 ug/ml Human heart.](http://images.novusbio.com/fullsize/TBC1D1-Antibody-Western-Blot-NBP1-54654-img0007.jpg "Western Blot: TBC1D1 Antibody [NBP1-54654] - Antibody Titration: 1 ug/ml Human heart.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to TBC1D1(TBC1 (tre-2/USP6, BUB2, cdc16) domain family, member 1) The peptide sequence was selected from the middle region of TBC1D1. Peptide sequence RGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHSW. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TBC1D1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 133 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for TBC1D1 Antibody (NBP1-54654)Find related products by research area.
|
|
Muscle-specific UBE2O ablation requires activated AMPK alpha 2 to protect against metabolic syndrome By Jamshed Arslan, Pharm. D., PhD. Generating energy (ATP) from nutrients is a recipe for life. One of the sensors of cellular energy levels is the serine/threonine kinase AMPK. This enzyme facilitates lipid oxidati... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: TBC1D1 Antibody [NBP1-54654] - Human Kidney tissue, 5 ug/ml.](http://images.novusbio.com/fullsize/TBC1D1-Antibody-Immunohistochemistry-Paraffin-NBP1-54654-img0003.jpg "Immunohistochemistry-Paraffin: TBC1D1 Antibody [NBP1-54654] - Human Kidney tissue, 5 ug/ml.")
![Western Blot: TBC1D1 Antibody [NBP1-54654] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://images.novusbio.com/fullsize/TBC1D1-Antibody-Western-Blot-NBP1-54654-img0004.jpg "Western Blot: TBC1D1 Antibody [NBP1-54654] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.")
![Western Blot: TBC1D1 Antibody [NBP1-54654] - Sample Tissue: Human ACHN Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/TBC1D1-Antibody-Western-Blot-NBP1-54654-img0006.jpg "Western Blot: TBC1D1 Antibody [NBP1-54654] - Sample Tissue: Human ACHN Antibody Dilution: 1.0 ug/ml")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Western_Blot_5219.jpg)
![Simple Western AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Simple_Western_16678.jpg)
![Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Immunocytochemistry__Immunofluorescence_19686.jpg)
![Western Blot AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_beta_1_AF2854_Western_Blot_5220.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023124938.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023125022.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")