![Western Blot: Symplekin Antibody (4C2) [H00008189-M03] - Analysis of SYMPK expression in transfected 293T cell line by SYMPK monoclonal antibody (M03), clone 4C2. Lane 1: SYMPK transfected lysatE (58.9 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Symplekin-Antibody-4C2-Western-Blot-H00008189-M03-img0007.jpg "Western Blot: Symplekin Antibody (4C2) [H00008189-M03] - Analysis of SYMPK expression in transfected 293T cell line by SYMPK monoclonal antibody (M03), clone 4C2. Lane 1: SYMPK transfected lysatE (58.9 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 4C2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SYMPK (AAH30214, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MASGSGDSVTRRSVASQFFTQEEGPGIDGMTTSERVVDLLNQAALITNDSKITVLKQVQELIINKDPTLLDNFLDEIIAFQADKSIEVRKFVIGFIEEACKRDIELLLKLIANLNMLLRDENVNVVKKAILTMTQLYKVALQWMVKSRVISELQEACWDMVSAMAGDIILLLDSDNDGIRTHAIKFVEGLIVTLSPRMADSEIPRRQEHDISLDRIPRDHPYIQYNVLWEEGKAALEQLLKFMVHPAISSINLTTALGSLANIARQRPMFMSEVIQAYETLHANLPPTLAKSQVSSVRKNLKLHLLSVLKHPASLEFQAQITTLLVDLGTPQAEIARNMPSSKDTRKRPRDDSDSTLKKMKLEPNLGEDDEDKDLEPGPSGTSKASAQISGQSDTDITAEFLQPLLTPDNVANLVLISMVYLPEAMPASFQAIYTPVESAGTEAQIKHLARLMATQMTAAGLGPGVEQTKQCKEEPKEEKVVKTESVLIKRRLSAQGQAISVVGSLSSMSPLEEEAPQAKRRPEPIIPVTQPR |
| Localization | Cytoplasm, cytoskeleton. Cell junction, adherens junction; Cytoplasmic side. Cell junction; Cytoplasmic side. Nucleus, nucleoplasm. Note=Cytoplasmic face of adhesion plaques (major) and nucleoplasm (minor) (in cells with TJ). Nucleoplasm (in cells without |
| Specificity | SYMPK - symplekin |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SYMPK |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF, IHC-P and ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Symplekin Antibody (4C2) [H00008189-M03] - Analysis of monoclonal antibody to SYMPK on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/Symplekin-Antibody-4C2-Immunocytochemistry-Immunofluorescence-H00008189-M03-img0005.jpg "Immunocytochemistry/Immunofluorescence: Symplekin Antibody (4C2) [H00008189-M03] - Analysis of monoclonal antibody to SYMPK on HeLa cell. Antibody concentration 10 ug/ml")
![Immunohistochemistry-Paraffin: Symplekin Antibody (4C2) [H00008189-M03] - Analysis of monoclonal antibody to SYMPK on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. Antibody concentration 3 ug/ml](http://images.novusbio.com/fullsize/Symplekin-Antibody-4C2-Immunohistochemistry-Paraffin-H00008189-M03-img0006.jpg "Immunohistochemistry-Paraffin: Symplekin Antibody (4C2) [H00008189-M03] - Analysis of monoclonal antibody to SYMPK on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. Antibody concentration 3 ug/ml")
![Western Blot: Symplekin Antibody (4C2) [H00008189-M03] - SYMPK expression in COLO 320 HSR ( Cat # L020V1 ).](http://images.novusbio.com/fullsize/Symplekin-Antibody-4C2-Western-Blot-H00008189-M03-img0001.jpg "Western Blot: Symplekin Antibody (4C2) [H00008189-M03] - SYMPK expression in COLO 320 HSR ( Cat # L020V1 ).")
![ELISA: Symplekin Antibody (4C2) [H00008189-M03] - Detection limit for recombinant GST tagged SYMPK is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Symplekin-Antibody-4C2-ELISA-H00008189-M03-img0004.jpg "ELISA: Symplekin Antibody (4C2) [H00008189-M03] - Detection limit for recombinant GST tagged SYMPK is approximately 0.03ng/ml as a capture antibody.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Immunocytochemistry_6472.jpg)
![Simple Western Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Simple_Western_18959.jpg)
![Western Blot Nucleostemin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nucleostemin_AF1638_Western_Blot_18960.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Bioactivity HGF [Unconjugated]](https://images.novusbio.com/images2/HGF_294HG_3253.jpg)
![Cell Culture HGF [Unconjugated]](https://images.novusbio.com/images/294-hg_recombinant-human-hgf-protein-cell-culture-252023111456.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")