![Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Knockout-Validated-NBP1-85047-img0019.jpg "Knockout Validated: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and TJP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:200 of Rabbit Anti-Human TJP1 Polyclonal Antibody (Catalog # NBP1-85047) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for TJP1 at approximately 260 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.")
| Reactivity | Hu, Mu, Rt, PoSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED |
| Marker | Intercellular Junctions/Tight Junction Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TJP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
James Xiao |
ICC | Rat | 12/10/2020 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Fabio Marongiu |
ICC | Human | 08/29/2017 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
James Xiao |
WB | Mouse | 06/22/2017 |
Summary
|
||||||||||
Enlarge |
reviewed by:
James Xiao |
ICC/IF | Mouse | 10/13/2016 |
Summary
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
ICC | Other | 02/02/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
|
Zonula Occludens (ZO) the Junction Scaffolding Proteins The Zonula Occludens (ZO) proteins 1,2 and 3, also known as tight junction proteins, are peripheral proteins localizing at junctional sites(1). ZO proteins are known to be scaffolding proteins recruiting various types of proteins to the cytoplasmic... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| James Xiao 12/10/2020 |
||
| Application: | ICC | |
| Species: | Rat |
| Fabio Marongiu 08/29/2017 |
||
| Application: | ICC | |
| Species: | Human |
| James Xiao 06/22/2017 |
||
| Application: | WB | |
| Species: | Mouse |
| Gene Symbol | TJP1 |
![Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85047-img0018.jpg "Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the same tissues.")
![Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047] - Simple Western lane view shows a specific band for TJP1 in 0.2 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Simple-Western-NBP1-85047-img0006.jpg "Simple Western: Tight Junction Protein 1 Antibody [NBP1-85047] - Simple Western lane view shows a specific band for TJP1 in 0.2 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.")
![Immunohistochemistry: Tight Junction Protein 1 Antibody [NBP1-85047] - Representative images of DCFA excretion at the biliary poles of corr-FH-iHeps. Left image FH-i, right image Corr-FH-iHeps. All images were taken with 10x objective, z-stacks of xy sections of the cells were acquired with an epifluorescence microscope (Nikon Elipse) and analyzed with ImageJ software. Image collected and cropped by CiteAb from the following publication (//stemcellres.biomedcentral.com/articles/10.1186/s13287-019-1342-6) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunohistochemistry-NBP1-85047-img0025.jpg "Immunohistochemistry: Tight Junction Protein 1 Antibody [NBP1-85047] - Representative images of DCFA excretion at the biliary poles of corr-FH-iHeps. Left image FH-i, right image Corr-FH-iHeps. All images were taken with 10x objective, z-stacks of xy sections of the cells were acquired with an epifluorescence microscope (Nikon Elipse) and analyzed with ImageJ software. Image collected and cropped by CiteAb from the following publication (//stemcellres.biomedcentral.com/articles/10.1186/s13287-019-1342-6) licensed under a CC-BY license.")
![Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Effects of dietary Flammulina velutipes stem waste (FVS) inclusion on the relative expression of tight junction proteins in jejunum of growing pigs. a The relative expression of ZO-1 in jejunum of growing pigs fed control and 2.5% or 5% FVS diets. Values are means (3 pigs per treatment) with standard errors represented by vertical bars. *P < 0.05, **P < 0.01. Image collected and cropped by CiteAb from the following publication (//jasbsci.biomedcentral.com/articles/10.1186/s40104-020-00449-y) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Western-Blot-NBP1-85047-img0026.jpg "Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Effects of dietary Flammulina velutipes stem waste (FVS) inclusion on the relative expression of tight junction proteins in jejunum of growing pigs. a The relative expression of ZO-1 in jejunum of growing pigs fed control and 2.5% or 5% FVS diets. Values are means (3 pigs per treatment) with standard errors represented by vertical bars. *P < 0.05, **P < 0.01. Image collected and cropped by CiteAb from the following publication (//jasbsci.biomedcentral.com/articles/10.1186/s40104-020-00449-y) licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Rat epithelial cells stained positively with Tight Junction Protein 1. Primary antibody at 1:100. Secondary antibody: goat anti-rabbit-Alexa 488 conjugated at 1:500. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0024.jpg "Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Rat epithelial cells stained positively with Tight Junction Protein 1. Primary antibody at 1:100. Secondary antibody: goat anti-rabbit-Alexa 488 conjugated at 1:500. ICC/IF image submitted by a verified customer review.")
![Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in control (vector only transfected HEK293T lysate) and TJP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Western-Blot-NBP1-85047-img0020.jpg "Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in control (vector only transfected HEK293T lysate) and TJP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Western-Blot-NBP1-85047-img0021.jpg "Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Analysis in human cell line A-431.")
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0013.jpg "Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.")
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0008.jpg "Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - The primary mouse lung endothelial cells were fixed, permeabilized and stained with 1:100 diluted anti-ZO-1 ab for overnight. Samples were washed and subsequently incubated with 1:500 diluted Alexa Fuor 546 at room temperature for 1 hour. ICC/iF image submitted by a verified customer reveiw.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0022.jpg "Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - The primary mouse lung endothelial cells were fixed, permeabilized and stained with 1:100 diluted anti-ZO-1 ab for overnight. Samples were washed and subsequently incubated with 1:500 diluted Alexa Fuor 546 at room temperature for 1 hour. ICC/iF image submitted by a verified customer reveiw.")
![Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Monolayer of Human ARPE-19 cells on a glass substrate. Tight Junction Protein 1 staining in red. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85047-img0023.jpg "Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Monolayer of Human ARPE-19 cells on a glass substrate. Tight Junction Protein 1 staining in red. ICC/IF image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85047-img0014.jpg "Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.")
![Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85047-img0015.jpg "Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85047-img0016.jpg "Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human skeletal muscle shows no membranous positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Tight-Junction-Protein-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85047-img0017.jpg "Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts.")
![Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot analysis of function protein expression on primary human renal cortical epithelial cells challenged with cytokines. Primary human renal tubular epithelial cells are challenged with cytokine cocktail (15nM IFN gamma , 6nM TNF alpha , & 3nM IL1 beta ). (A, B) Expression of Snail, E-Cad, TJP1, SMA. AhR, IDO, KMO, KY, MHCI & II. (C, D) Densitometric quantitation of protein in (A, B). All Western blots are representative of at least three independent experiments. *P < 0.05, ***P < 0.0001 versus to cells without treatment, analysis is multiple t-tests, pairwise comparison of individual time-point to control indicated same p-value. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85047_rabbit-polyclonal-tight-junction-protein-1-antibody-310202415384165.jpg "Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Western blot analysis of function protein expression on primary human renal cortical epithelial cells challenged with cytokines. Primary human renal tubular epithelial cells are challenged with cytokine cocktail (15nM IFN gamma , 6nM TNF alpha , & 3nM IL1 beta ). (A, B) Expression of Snail, E-Cad, TJP1, SMA. AhR, IDO, KMO, KY, MHCI & II. (C, D) Densitometric quantitation of protein in (A, B). All Western blots are representative of at least three independent experiments. *P < 0.05, ***P < 0.0001 versus to cells without treatment, analysis is multiple t-tests, pairwise comparison of individual time-point to control indicated same p-value. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Effects of dietary Flammulina velutipes stem waste (FVS) inclusion on the relative expression of tight junction proteins in jejunum of growing pigs. a The relative expression of ZO-1 in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. b The relative expression of occludin in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. c The relative expression of claudin-1 in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. Values are means (3 pigs per treatment) with standard errors represented by vertical bars. *P < 0.05, **P < 0.01 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32391146), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85047_rabbit-polyclonal-tight-junction-protein-1-antibody-310202415395958.jpg "Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Effects of dietary Flammulina velutipes stem waste (FVS) inclusion on the relative expression of tight junction proteins in jejunum of growing pigs. a The relative expression of ZO-1 in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. b The relative expression of occludin in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. c The relative expression of claudin-1 in jejunum of growing pigs fed control & 2.5% or 5% FVS diets. Values are means (3 pigs per treatment) with standard errors represented by vertical bars. *P < 0.05, **P < 0.01 Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32391146), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Differentiation of FH- & corr-FH-iPSCs into hepatocytes. a Representative pictures of cell morphology & immunostainings of the indicated markers at day 25 of differentiation. Scale bars: 50 μm. b Representative images of DCFA excretion at the biliary poles of corr-FH-iHeps. All images were taken with × 10 objective, z-stacks of xy sections of the cells were acquired with an epifluorescence microscope (Nikon Elipse) & analyzed with ImageJ software. Arrowheads indicate bile canaliculi Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31358055), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85047_rabbit-polyclonal-tight-junction-protein-1-antibody-31020241539255.jpg "Immunocytochemistry/ Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Differentiation of FH- & corr-FH-iPSCs into hepatocytes. a Representative pictures of cell morphology & immunostainings of the indicated markers at day 25 of differentiation. Scale bars: 50 μm. b Representative images of DCFA excretion at the biliary poles of corr-FH-iHeps. All images were taken with × 10 objective, z-stacks of xy sections of the cells were acquired with an epifluorescence microscope (Nikon Elipse) & analyzed with ImageJ software. Arrowheads indicate bile canaliculi Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31358055), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the cells are challenged with the cytokine cocktail (15 nM IFN gamma , 6 nM TNF alpha , & 3 nM IL1 beta ) for 24Â h; protein expression was assayed with Western blot: (A, B) 3HK & 3HAA cannot reverse IDO, MHC I, BID expression induced by cytokines. 3HK & 3HAA effectively restore Bcl-xL & Tjp1 expression. 3HAA shows its different function in up-regulation of AhR expression in TEC in inflammatory conditions. (C) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HK. ***P < 0.0001 versus cell treated with Cyto. (D) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HAA. ***P < 0.0001, ****P < 0.00001 versus cell treated with Cyto. Pairwise comparison of individual dose to control indicated same p-value. All Western blots are representative of three independent experiments; analysis is multiple one-way ANOVA. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85047_rabbit-polyclonal-tight-junction-protein-1-antibody-3102024161362.jpg "Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the cells are challenged with the cytokine cocktail (15 nM IFN gamma , 6 nM TNF alpha , & 3 nM IL1 beta ) for 24Â h; protein expression was assayed with Western blot: (A, B) 3HK & 3HAA cannot reverse IDO, MHC I, BID expression induced by cytokines. 3HK & 3HAA effectively restore Bcl-xL & Tjp1 expression. 3HAA shows its different function in up-regulation of AhR expression in TEC in inflammatory conditions. (C) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HK. ***P < 0.0001 versus cell treated with Cyto. (D) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HAA. ***P < 0.0001, ****P < 0.00001 versus cell treated with Cyto. Pairwise comparison of individual dose to control indicated same p-value. All Western blots are representative of three independent experiments; analysis is multiple one-way ANOVA. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the cells are challenged with the cytokine cocktail (15 nM IFN gamma , 6 nM TNF alpha , & 3 nM IL1 beta ) for 24Â h; protein expression was assayed with Western blot: (A, B) 3HK & 3HAA cannot reverse IDO, MHC I, BID expression induced by cytokines. 3HK & 3HAA effectively restore Bcl-xL & Tjp1 expression. 3HAA shows its different function in up-regulation of AhR expression in TEC in inflammatory conditions. (C) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HK. ***P < 0.0001 versus cell treated with Cyto. (D) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HAA. ***P < 0.0001, ****P < 0.00001 versus cell treated with Cyto. Pairwise comparison of individual dose to control indicated same p-value. All Western blots are representative of three independent experiments; analysis is multiple one-way ANOVA. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-85047_rabbit-polyclonal-tight-junction-protein-1-antibody-310202416114731.jpg "Western Blot: Tight Junction Protein 1 Antibody [NBP1-85047] - Protective role of 3HK & 3HAA in TEC stimulated with cytokines. Primary human renal TEC pre-incubated with different doses of 3HK or 3HAA overnight; the cells are challenged with the cytokine cocktail (15 nM IFN gamma , 6 nM TNF alpha , & 3 nM IL1 beta ) for 24Â h; protein expression was assayed with Western blot: (A, B) 3HK & 3HAA cannot reverse IDO, MHC I, BID expression induced by cytokines. 3HK & 3HAA effectively restore Bcl-xL & Tjp1 expression. 3HAA shows its different function in up-regulation of AhR expression in TEC in inflammatory conditions. (C) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HK. ***P < 0.0001 versus cell treated with Cyto. (D) Qualification of protein expression in TEC challenged with cytokine cocktail in the presence of 3HAA. ***P < 0.0001, ****P < 0.00001 versus cell treated with Cyto. Pairwise comparison of individual dose to control indicated same p-value. All Western blots are representative of three independent experiments; analysis is multiple one-way ANOVA. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/34305900), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
