Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 292-391 of human SOX1 (NP_005977.2). HQNSAVAAAAAAAAASSGALGALGSLVKSEPSGSPPAPAHSRAPCPGDLREMISMYLPAGEGGDPAAAAAAAAQSRLHSLPQHYQGAGAGVNGTVPLTHI |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SOX1 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 50% glycerol, pH7.3 |
Preservative | 0.05% Proclin 300 |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Deriving neural precursor cells from human induced pluripotent stem cells By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SOX1 |