Home » SMARCA6 » SMARCA6 Proteins » SMARCA6 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

SMARCA6 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for SMARCA6 Protein (NBP2-38986PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

SMARCA6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HELLS.

Source: E. coli

Amino Acid Sequence: VVYAPLSKKQEIFYTAIVNRTIANMFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HELLS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38986.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for SMARCA6 Recombinant Protein Antigen

  • EC 3.6.1
  • EC 3.6.4.-
  • helicase, lymphoid-specific
  • LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin
  • Nbla10143
  • PASGFLJ10339
  • Proliferation-associated SNF2-like protein
  • SMARCA6lymphoid-specific helicase
  • subfamily A, member 6
  • SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6

Background

HELLS, also known as LSH (lymphoid specific helicase), is a member of the SNF2 superfamily of chromatin helicases. HELLS is ubiquitously expressed and is required for the maintenance of normal DNA methylation patterns important to organism development. HELLS function has also been shown to be important to the regulation of proliferation and the expression of senescence-related genes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NRAMP1/SLC11A1
Antibody (910825)
MAB8400
Western Blot NRAMP1/SLC11A1 Antibody (910825)
Flow Cytometry NRAMP1/SLC11A1 Antibody (910825)
Species: Hu
Applications: CyTOF-ready, Flow, WB
Brg1 Antibody
[Unconjugated]
AF5738
Western Blot Brg1 Antibody [Unconjugated]
Immunocytochemistry Brg1 Antibody [Unconjugated]
Immunocytochemistry Brg1 Antibody [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, KO, WB
BRM Antibody
NBP3-13283
Immunohistochemistry-Paraffin BRM Antibody
Immunohistochemistry-Paraffin BRM Antibody
Immunocytochemistry/ Immunofluorescence BRM Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin BRD2 Antibody
Immunocytochemistry/ Immunofluorescence BRD2 Antibody
Immunoprecipitation BRD2 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
non-muscle Myosin
IIA Antibody (2B3)
H00004627-M03
Immunocytochemistry/ Immunofluorescence non-muscle Myosin IIA Antibody (2B3)
Western Blot non-muscle Myosin IIA Antibody (2B3)
ELISA non-muscle Myosin IIA Antibody (2B3)
(1 Review)
(2 Publications)
Species: Bv, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DNMT1 Antibody
(60B1220.1) - BSA Fre
NB100-56519
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Flow Cytometry DNMT1 Antibody (60B1220.1) - BSA Free
Immunoprecipitation DNMT1 Antibody (60B1220.1) - BSA Free
(4 Reviews)
(144 Publications)
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB
DNMT3B Antibody
NB300-516
Western Blot DNMT3B Antibody
Knockdown Validated DNMT3B Antibody
Western Blot DNMT3B Antibody
(3 Reviews)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, KD, Simple Western, WB

NRAMP2/SLC11A2/DMT1 An
H00004891-M01
Immunohistochemistry-Paraffin NRAMP2/SLC11A2/DMT1 Antibody (4C6)
Immunohistochemistry NRAMP2/SLC11A2/DMT1 Antibody (4C6)
Immunohistochemistry NRAMP2/SLC11A2/DMT1 Antibody (4C6)
(9 Publications)
Species: Bv, Hu, Mu, Po
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(818 Publications)
Species: Hu
Applications: BA
Recombinant Human
ALPK1 GST (N-Term) Pr ...
H00080216-Q01
SDS-PAGE Recombinant Human ALPK1 GST (N-Term) Protein
(2 Publications)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
ARL4C Antibody
NBP1-88988
Immunocytochemistry/ Immunofluorescence ARL4C Antibody
Western Blot ARL4C Antibody
Species: Hu
Applications: ICC/IF, KD, WB
ENPP-3/CD203c
Antibody (NP4D6) - BS ...
NBP1-44643
Flow Cytometry ENPP-3/CD203c Antibody (NP4D6) - BSA Free
Immunocytochemistry/ Immunofluorescence ENPP-3/CD203c Antibody (NP4D6) - BSA Free
Flow Cytometry ENPP-3/CD203c Antibody (NP4D6) - BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
SOD1/Cu-Zn SOD
Antibody
NBP2-24915
Western Blot SOD1/Cu-Zn SOD Antibody
Western Blot SOD1/Cu-Zn SOD Antibody
Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody
(3 Reviews)
(21 Publications)
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SMARCA1 Antibody
(2H7B8) - BSA Free
NBP2-61879
ELISA SMARCA1 Antibody (2H7B8) - BSA Free
Flow Cytometry SMARCA1 Antibody (2H7B8) - BSA Free
Immunohistochemistry SMARCA1 Antibody (2H7B8) - BSA Free
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
SMARCA6
Recombinant Protein A
NBP2-38986PEP
SMARCA6 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for SMARCA6 Protein (NBP2-38986PEP) (0)

There are no publications for SMARCA6 Protein (NBP2-38986PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMARCA6 Protein (NBP2-38986PEP) (0)

There are no reviews for SMARCA6 Protein (NBP2-38986PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for SMARCA6 Protein (NBP2-38986PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SMARCA6 Products

Research Areas for SMARCA6 Protein (NBP2-38986PEP)

Find related products by research area.

Blogs on SMARCA6

There are no specific blogs for SMARCA6, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Flow Cytometry: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of PE conjugate of NB100-56519. An intracellular stain was performed on HeLa cells with DNMT1 antibody (60B1220.1) NB100-56519PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0
DNMT1 Antibody (60B1220.1) - BSA Free
NB100-56519

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our SMARCA6 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HELLS