![Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in transfected 293T cell line by MYH9 monoclonal antibody (M03), clone 2B3. Lane 1: MYH9 transfected lysate (Predicted MW: 10.01 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/non-muscle-Myosin-IIA-Antibody-2B3-Western-Blot-H00004627-M03-img0006.jpg "Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in transfected 293T cell line by MYH9 monoclonal antibody (M03), clone 2B3. Lane 1: MYH9 transfected lysate (Predicted MW: 10.01 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | Hu, BvSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 2B3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | MYH9 (NP_002464.1, 1871 a.a. ~ 1960 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE |
| Specificity | MYH9 (2B3) |
| Isotype | IgG2b Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | MYH9 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Valentina Lodde |
immunofluorescence on in vitro grown cells | Bovine | 06/22/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for non-muscle Myosin IIA Antibody (H00004627-M03)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Valentina Lodde 06/22/2018 |
||
| Application: | immunofluorescence on in vitro grown cells | |
| Species: | Bovine |
![Immunocytochemistry/Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Bovine ovarian granulosa cells. Anti Myosin IIA immunofluorescent staining (green). DNA in counterstained with DAPI (blue). Control was obtained by omitting the primary antibody. Fixation: 4% PF for 7 minutes at rt. Permeabilization: 0.1% Triton-X in PBS for 7 minutes. Blocking: 20% donkey serum, 1% BSA in PBS, 1 hour at rt. Primary antibody: 1:50 or 1:100 in 1% BSA/PBS over night at 4C. Secondary antibody: donkey anti mouse -Alexa 488 (Invitrogen), 1:500. DNA Counterstaining: mounting medium with DAPI. Negative CTRL was performed by omitting the primary antibody, images were captured under an epifluorescence microscope. Image from verified customer review.](http://images.novusbio.com/fullsize/non-muscle-Myosin-IIA-Antibody-2B3-Immunocytochemistry-Immunofluorescence-H00004627-M03-img0007.jpg "Immunocytochemistry/Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Bovine ovarian granulosa cells. Anti Myosin IIA immunofluorescent staining (green). DNA in counterstained with DAPI (blue). Control was obtained by omitting the primary antibody. Fixation: 4% PF for 7 minutes at rt. Permeabilization: 0.1% Triton-X in PBS for 7 minutes. Blocking: 20% donkey serum, 1% BSA in PBS, 1 hour at rt. Primary antibody: 1:50 or 1:100 in 1% BSA/PBS over night at 4C. Secondary antibody: donkey anti mouse -Alexa 488 (Invitrogen), 1:500. DNA Counterstaining: mounting medium with DAPI. Negative CTRL was performed by omitting the primary antibody, images were captured under an epifluorescence microscope. Image from verified customer review.")
![Immunohistochemistry-Paraffin: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of monoclonal antibody to MYH9 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 0.5 ug/ml](http://images.novusbio.com/fullsize/non-muscle-Myosin-IIA-Antibody-2B3-Immunohistochemistry-Paraffin-H00004627-M03-img0003.jpg "Immunohistochemistry-Paraffin: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of monoclonal antibody to MYH9 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 0.5 ug/ml")
![Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in HeLa.](http://images.novusbio.com/fullsize/non-muscle-Myosin-IIA-Antibody-2B3-Western-Blot-H00004627-M03-img0004.jpg "Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in HeLa.")
![Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in human kidney.](http://images.novusbio.com/fullsize/non-muscle-Myosin-IIA-Antibody-2B3-Western-Blot-H00004627-M03-img0005.jpg "Western Blot: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of MYH9 expression in human kidney.")
![Immunocytochemistry/Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of monoclonal antibody to MYH9 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize/non-muscle-Myosin-IIA-Antibody-2B3-Immunocytochemistry-Immunofluorescence-H00004627-M03-img0002.jpg "Immunocytochemistry/Immunofluorescence: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Analysis of monoclonal antibody to MYH9 on HeLa cell. Antibody concentration 10 ug/ml")
![ELISA: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/non-muscle-Myosin-IIA-Antibody-2B3-ELISA-H00004627-M03-img0001.jpg "ELISA: non-muscle Myosin IIA Antibody (2B3) [H00004627-M03] - Detection limit for recombinant GST tagged MYH9 is approximately 0.03ng/ml as a capture antibody.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_6775.jpg)
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_10004.jpg)
![Immunocytochemistry/ Immunofluorescence Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images/af3159_mouse-nephrin-affinity-purified-polyclonal-ab-41202410484365.jpg)
![Western Blot Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Western_Blot_5648.jpg)
![Immunohistochemistry Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images2/Uromodulin_AF5175_Immunohistochemistry_12099.jpg)
![Immunocytochemistry/ Immunofluorescence Uromodulin Antibody [Unconjugated]](https://images.novusbio.com/images/af5175_mouse-uromodulin-affinity-purified-polyclonal-ab-41202410481117.jpg)
