![Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of iron handling proteins in healthy kidney. Representatives images of ZIP8 (a), ZIP14 (b), divalent metal transporter 1 (DMT1; c), L-ferritin (d), H-ferritin (e), and ferroportin (f) staining in healthy kidney. Renal structures indicated as glomerulus (g), proximal tubule (PT), distal tubule (DT). Scale bar 20uM. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-018-27107-8) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/NRAMP2-SLC11A2-DMT1-Antibody-4C6-Immunohistochemistry-Paraffin-H00004891-M01-img0009.jpg "Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of iron handling proteins in healthy kidney. Representatives images of ZIP8 (a), ZIP14 (b), divalent metal transporter 1 (DMT1; c), L-ferritin (d), H-ferritin (e), and ferroportin (f) staining in healthy kidney. Renal structures indicated as glomerulus (g), proximal tubule (PT), distal tubule (DT). Scale bar 20uM. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41598-018-27107-8) licensed under a CC-BY license.")
| Reactivity | Hu, Mu, Po, BvSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, IP |
| Clone | 4C6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC11A2 (NP_000608, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVLGPEQKMSDDSVSGDHGESASLGNINPAYSNPSLSQSPGDSEEYFATYFNEKISIPEEEYSCF |
| Specificity | SLC11A2 - solute carrier family 11 (proton-coupled divalent metal ion transporters), member 2 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | SLC11A2 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | It has been used for IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 29921869). |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/NRAMP2-SLC11A2-DMT1-Antibody-4C6-Immunohistochemistry-Paraffin-H00004891-M01-img0006.jpg "Immunohistochemistry-Paraffin: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Analysis of monoclonal antibody to SLC11A2 on formalin-fixed paraffin-embedded human endometrium cancer. Antibody concentration 3 ug/ml.")
![ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/NRAMP2-SLC11A2-DMT1-Antibody-4C6-ELISA-H00004891-M01-img0008.jpg "ELISA: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Detection limit for recombinant GST tagged SLC11A2 is 0.03 ng/ml as a capture antibody.")
![Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of iron handling proteins in healthy kidney. Representatives images of ZIP8 (a), ZIP14 (b), divalent metal transporter 1 (DMT1; c), L-ferritin (d), H-ferritin (e), & ferroportin (f) staining in healthy kidney. Renal structures indicated as glomerulus (g), proximal tubule (PT), distal tubule (DT). Scale bar 20 µM. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29921869), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00004891-m01_mouse-monoclonal-nramp2-slc11a2-dmt1-antibody-4c6-310202415384187.jpg "Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of iron handling proteins in healthy kidney. Representatives images of ZIP8 (a), ZIP14 (b), divalent metal transporter 1 (DMT1; c), L-ferritin (d), H-ferritin (e), & ferroportin (f) staining in healthy kidney. Renal structures indicated as glomerulus (g), proximal tubule (PT), distal tubule (DT). Scale bar 20 µM. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29921869), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of putative iron importers in chronic kidney disease. Representative images of ZIP8 (a–f), ZIP14 (g–l), & divalent metal transporter 1 (DMT1; m–r) staining in control (a,g,m), early diabetic nephropathy (DNE; b,h,n), advanced diabetic nephropathy (DNA; c,i,o), focal segmental glomerulosclerosis (FSGS; d,j,p), lupus nephritis (LN; e,k,q) & IgA nephropathy (IgAN; f,l,r). Intensity in proximal & distal tubules quantified (s). Dots represent all quantified images (5 images per biopsy). Renal structures indicated as glomerulus (G), proximal tubule (PT), distal tubule (DT). Scale bar 40 µM. **p < 0.01; ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29921869), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/h00004891-m01_mouse-monoclonal-nramp2-slc11a2-dmt1-antibody-4c6-31020241534339.jpg "Immunohistochemistry: NRAMP2/SLC11A2/DMT1 Antibody (4C6) [H00004891-M01] - Immunohistochemistry of putative iron importers in chronic kidney disease. Representative images of ZIP8 (a–f), ZIP14 (g–l), & divalent metal transporter 1 (DMT1; m–r) staining in control (a,g,m), early diabetic nephropathy (DNE; b,h,n), advanced diabetic nephropathy (DNA; c,i,o), focal segmental glomerulosclerosis (FSGS; d,j,p), lupus nephritis (LN; e,k,q) & IgA nephropathy (IgAN; f,l,r). Intensity in proximal & distal tubules quantified (s). Dots represent all quantified images (5 images per biopsy). Renal structures indicated as glomerulus (G), proximal tubule (PT), distal tubule (DT). Scale bar 40 µM. **p < 0.01; ***p < 0.001. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/29921869), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![N/A Hepcidin Antimicrobial Peptide [HRP]](https://images.novusbio.com/images2/Hepcidin_DHP250_ELISA_1121.jpg)
![N/A Hepcidin Antimicrobial Peptide [HRP]](https://images.novusbio.com/images2/Hepcidin_DHP250_ELISA_1122.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
