Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Format | Azide and BSA Free |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 289-348 of human SLC10A2 (NP_000443.1). FPLIYSIFQLAFAAIFLGFYVAYKKCHGKNKAEIPESKENGTEPESSFYKANGGFQPDEK |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SLC10A2 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | SLC10A2 antibody validated for WB from a verified customer review. |
|
Theoretical MW | 37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
Reviewed Applications |
|
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol |
Preservative | 0.01% Thimerosal |
Purity | Affinity purified |
Images | Ratings | Applications | Species | Date | Details | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
reviewed by:
Verified Customer |
WB and Immunofluorescence | Human | 12/18/2023 |
Summary
Comments
|
|||||||||||
![]() Enlarge |
reviewed by:
Hua Jiang |
WB | Mouse | 03/09/2021 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
Verified Customer 12/18/2023 |
||
Application: | WB and Immunofluorescence | |
Species: | Human |
Hua Jiang 03/09/2021 |
||
Application: | WB | |
Species: | Mouse |
Gene Symbol | SLC10A2 |