![Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Analysis in human kidney and endometrium tissues. Corresponding SLC5A2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SGLT2-SLC5A2-Antibody-Immunohistochemistry-Paraffin-NBP1-92384-img0010.jpg "Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Analysis in human kidney and endometrium tissues. Corresponding SLC5A2 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, Ca, Tn, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC5A2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Vojtech Gabriel |
IHC-P | Tenrec | 05/11/2022 |
Summary
|
|||||||||||
|
reviewed by:
Verified Customer |
IHC-P | Canine | 03/23/2022 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for SGLT2/SLC5A2 Antibody (NBP1-92384)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Vojtech Gabriel 05/11/2022 |
||
| Application: | IHC-P | |
| Species: | Tenrec |
| Verified Customer 03/23/2022 |
||
| Application: | IHC-P | |
| Species: | Canine |
| Gene Symbol | SLC5A2 |
![Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - SGLT2/SLC5A2 used at 1:50 on a tenrec kidney. SGLT2/SLC5A2 antibody was used on paraffin-embedded kidney tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Citrate buffer (pH6) for two hours at 75C. Image from verified customer review.](http://images.novusbio.com/fullsize/SGLT2-SLC5A2-Antibody-Immunohistochemistry-Paraffin-NBP1-92384-img0016.jpg "Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - SGLT2/SLC5A2 used at 1:50 on a tenrec kidney. SGLT2/SLC5A2 antibody was used on paraffin-embedded kidney tissue at a concentration of 20ug/mL and left at 4C overnight. HIER was performed in Citrate buffer (pH6) for two hours at 75C. Image from verified customer review.")
![Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/SGLT2-SLC5A2-Antibody-Immunohistochemistry-Paraffin-NBP1-92384-img0011.jpg "Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/SGLT2-SLC5A2-Antibody-Immunohistochemistry-Paraffin-NBP1-92384-img0012.jpg "Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/SGLT2-SLC5A2-Antibody-Immunohistochemistry-Paraffin-NBP1-92384-img0014.jpg "Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human kidney shows moderate positivity in apical membrane in cells in tubules.](http://images.novusbio.com/fullsize/SGLT2-SLC5A2-Antibody-Immunohistochemistry-Paraffin-NBP1-92384-img0013.jpg "Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Staining of human kidney shows moderate positivity in apical membrane in cells in tubules.")
![Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Analysis of SGLT2/SLC5A2 antibody on Canine kidney tissue. HIER was done in pH 6 (Citrate Buffer) for two hours at 75C, and primary antibody was put on at 1:100 overnight at 4C. Image was taken at 40X. Image from verified customer review.](http://images.novusbio.com/fullsize/SGLT2-SLC5A2-Antibody-Immunohistochemistry-Paraffin-NBP1-92384-img0015.jpg "Immunohistochemistry-Paraffin: SGLT2/SLC5A2 Antibody [NBP1-92384] - Analysis of SGLT2/SLC5A2 antibody on Canine kidney tissue. HIER was done in pH 6 (Citrate Buffer) for two hours at 75C, and primary antibody was put on at 1:100 overnight at 4C. Image was taken at 40X. Image from verified customer review.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
