![Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Analysis in human esophagus and stomach tissues. Corresponding S100A9 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/S100A9-Antibody-Immunohistochemistry-Paraffin-NBP1-89360-img0009.jpg "Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Analysis in human esophagus and stomach tissues. Corresponding S100A9 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | S100A9 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for S100A9 Antibody (NBP1-89360)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | S100A9 |
![Western Blot: S100A9 Antibody [NBP1-89360] - Analysis in human cell line SK-BR-3.](http://images.novusbio.com/fullsize/S100A9-Antibody-Western-Blot-NBP1-89360-img0008.jpg "Western Blot: S100A9 Antibody [NBP1-89360] - Analysis in human cell line SK-BR-3.")
![Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human stomach shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/S100A9-Antibody-Immunohistochemistry-Paraffin-NBP1-89360-img0014.jpg "Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human stomach shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human esophagus shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/S100A9-Antibody-Immunohistochemistry-Paraffin-NBP1-89360-img0010.jpg "Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human esophagus shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of hematopoietic cells.](http://images.novusbio.com/fullsize/S100A9-Antibody-Immunohistochemistry-Paraffin-NBP1-89360-img0011.jpg "Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human bone marrow shows strong cytoplasmic positivity in a subset of hematopoietic cells.")
![Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/S100A9-Antibody-Immunohistochemistry-Paraffin-NBP1-89360-img0012.jpg "Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human skin shows moderate to strong cytoplasmic and nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human duodenumshows strong cytoplasmic positivity in peripheral leukocytes.](http://images.novusbio.com/fullsize/S100A9-Antibody-Immunohistochemistry-Paraffin-NBP1-89360-img0013.jpg "Immunohistochemistry-Paraffin: S100A9 Antibody [NBP1-89360] - Staining of human duodenumshows strong cytoplasmic positivity in peripheral leukocytes.")
![Simple Western: S100A9 Antibody [NBP1-89360] - Simple Western lane view shows a specific band for S100A9 in 0.2 mg/ml of h. Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/S100A9-Antibody-Simple-Western-NBP1-89360-img0006.jpg "Simple Western: S100A9 Antibody [NBP1-89360] - Simple Western lane view shows a specific band for S100A9 in 0.2 mg/ml of h. Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: S100A9 Antibody [NBP1-89360] - Electropherogram image(s) of corresponding Simple Western lane view. S100A9 antibody was used at 1:20 dilution on h. Tonsil lysate(s).](http://images.novusbio.com/fullsize/S100A9-Antibody-Simple-Western-NBP1-89360-img0007.jpg "Simple Western: S100A9 Antibody [NBP1-89360] - Electropherogram image(s) of corresponding Simple Western lane view. S100A9 antibody was used at 1:20 dilution on h. Tonsil lysate(s).")
![Immunocytochemistry S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry_6489.jpg)
![Western Blot S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Immunocytochemistry__Immunofluorescence_17308.jpg)
![Simple Western S100A8 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A8_AF3059_Simple_Western_18694.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Western_Blot_17324.jpg)
![Immunohistochemistry S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Immunohistochemistry_17440.jpg)
![Simple Western S100A10 Antibody [Unconjugated]](https://images.novusbio.com/images2/S100A10_AF2377_Simple_Western_18705.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")