![Western Blot: RPA2 Antibody [NBP1-89524] - Analysis using Anti-RPA2 antibody NBP1-89524 (A) shows similar pattern to independent antibody NBP1-89523 (B).](http://images.novusbio.com/fullsize/RPA2-Antibody-Western-Blot-NBP1-89524-img0010.jpg "Western Blot: RPA2 Antibody [NBP1-89524] - Analysis using Anti-RPA2 antibody NBP1-89524 (A) shows similar pattern to independent antibody NBP1-89523 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HMVLSKANSQPSAGRAPISNPGMSEAGNFGGNSFMPANGLTVAQNQVLNLIKACPRPEGLNFQDLKNQLKHMSVSSIKQAVDFLSNEGHIYSTVDDDH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RPA2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RPA2 Antibody (NBP1-89524)Find related products by research area.
|
|
Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD) Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm. Transportin 1 is co... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RPA2 |
![Immunocytochemistry/Immunofluorescence: RPA2 Antibody [NBP1-89524] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RPA2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89524-img0007.jpg "Immunocytochemistry/Immunofluorescence: RPA2 Antibody [NBP1-89524] - Staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.](http://images.novusbio.com/fullsize/RPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89524-img0014.jpg "Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Testis shows moderate nuclear positivity in cells in seminiferous ducts and Leydig cells.")
![Western Blot: RPA2 Antibody [NBP1-89524] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/RPA2-Antibody-Western-Blot-NBP1-89524-img0006.jpg "Western Blot: RPA2 Antibody [NBP1-89524] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89524-img0011.jpg "Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/RPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89524-img0012.jpg "Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Liver shows very weak nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Testis cancer, carcinoma shows strong nuclear positivity in tumor cells.](http://images.novusbio.com/fullsize/RPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89524-img0013.jpg "Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Testis cancer, carcinoma shows strong nuclear positivity in tumor cells.")
![Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Tonsil shows moderate nuclear positivity in non-germinal and germinal center cells.](http://images.novusbio.com/fullsize/RPA2-Antibody-Immunohistochemistry-Paraffin-NBP1-89524-img0015.jpg "Immunohistochemistry-Paraffin: RPA2 Antibody [NBP1-89524] - Staining of human Tonsil shows moderate nuclear positivity in non-germinal and germinal center cells.")
![Western Blot Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Western_Blot_5182.jpg)
![Simple Western Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/16395.jpg)
![Immunocytochemistry Histone H2AX [p Ser139] Antibody [Unconjugated]](https://images.novusbio.com/images2/Histone_H2AX_AF2288_Immunocytochemistry__Immunofluorescence_16920.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")