RENBP Antibody - BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 187-390 of human RENBP (NP_002901.2). EPMAVPMMLLNLVEQLGEADEELAGKYAELGDWCARRILQHVQRDGQAVLENVSEGGKELPGCLGRQQNPGHTLEAGWFLLRHCIRKGDPELRAHVIDKFLLLPFHSGWDPDHGGLFYFQDADNFCPTQLEWAMKLWWPHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSREGKVALSIKGGPFKGC |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
RENBP |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500-1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for RENBP Antibody - BSA Free
Background
RENBP, also known as N-acylglucosamine 2-epimerase, is a 49kDa 427 amino acid protein with a shorter 29kDa 254 isoform produced by alternative splicing. RENBP functions as a catalyzer in the conversion of N-acetylglucosamine to N-acetylmannosamine. Current research is being conducted on RENBP in relation to sialuria, Wilms tumor, allergic rhinitis, myopathy, vascular disease, hypertension, nephropathy, proteinuria and aldosteronism. RENBP has been linked to the amino sugar and nucleotide sugar metabolism pathways where it interacts with HEXA, HEXB, GNE, REN and ZBED1.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for RENBP Antibody (NBP2-95119) (0)
There are no publications for RENBP Antibody (NBP2-95119).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for RENBP Antibody (NBP2-95119) (0)
There are no reviews for RENBP Antibody (NBP2-95119).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for RENBP Antibody (NBP2-95119) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional RENBP Products
Research Areas for RENBP Antibody (NBP2-95119)
Find related products by research area.
|
Blogs on RENBP