![Western Blot: RBM15 Antibody [NBP1-82465] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/RBM15-Antibody-Western-Blot-NBP1-82465-img0009.jpg "Western Blot: RBM15 Antibody [NBP1-82465] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DTYPPSASVVGASVGGHRHPPGGGGGQRSLSPGGAALGYRDYRLQQLALGRLPPPPPPPLPRDLERERDYPFYERVRPAYSLEPRVGAGAGAAPFREVDEISPEDDQRANRTLFL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RBM15 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
| Publication using NBP1-82465 | Applications | Species |
|---|---|---|
| Chen B, Shi H, Zhang J Et al. CRISPR-based RNA-binding protein mapping in live cells Biochemical and biophysical research communications 2021-10-29 [PMID: 34735883] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RBM15 |
![Immunocytochemistry/Immunofluorescence: RBM15 Antibody [NBP1-82465] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RBM15-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82465-img0010.jpg "Immunocytochemistry/Immunofluorescence: RBM15 Antibody [NBP1-82465] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/RBM15-Antibody-Immunohistochemistry-Paraffin-NBP1-82465-img0015.jpg "Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Western Blot: RBM15 Antibody [NBP1-82465] - Analysis in human cell line K562.](http://images.novusbio.com/fullsize/RBM15-Antibody-Western-Blot-NBP1-82465-img0008.jpg "Western Blot: RBM15 Antibody [NBP1-82465] - Analysis in human cell line K562.")
![Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human colon shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/RBM15-Antibody-Immunohistochemistry-Paraffin-NBP1-82465-img0006.jpg "Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human colon shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Analysis in human lymph node and pancreas tissues. Corresponding RBM15 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RBM15-Antibody-Immunohistochemistry-Paraffin-NBP1-82465-img0011.jpg "Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Analysis in human lymph node and pancreas tissues. Corresponding RBM15 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human lymph node shows moderate nuclear positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/RBM15-Antibody-Immunohistochemistry-Paraffin-NBP1-82465-img0012.jpg "Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human lymph node shows moderate nuclear positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/RBM15-Antibody-Immunohistochemistry-Paraffin-NBP1-82465-img0013.jpg "Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human pancreas shows very weak nuclear positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/RBM15-Antibody-Immunohistochemistry-Paraffin-NBP1-82465-img0014.jpg "Immunohistochemistry-Paraffin: RBM15 Antibody [NBP1-82465] - Staining of human placenta shows moderate to strong nuclear positivity in trophoblastic cells.")
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/DATA_tPlasminogen_Activator_DTPA00_ELISA_854.jpg)
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/tPlasminogen_Activator_DTPA00_ELISA_510.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![Western Blot Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Western_Blot_9426.jpg)
![Immunohistochemistry Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/Raf-1_MAB4540_Immunohistochemistry_9891.jpg)
![Simple Western Raf-1 Antibody (563002) [Unconjugated]](https://images.novusbio.com/images2/mab4540_human-mouse-rat-raf-1-mab-clone-563002-simple-western-158202212919.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")