Novus Biologicals products are now on bio-techne.com

RAD52 Recombinant Protein Antigen

Images

 
There are currently no images for RAD52 Recombinant Protein Antigen (NBP2-58116PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

RAD52 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RAD52.

Source: E. coli

Amino Acid Sequence: ILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
RAD52
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58116.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RAD52 Recombinant Protein Antigen

  • DNA repair protein RAD52 homolog
  • RAD52 (S. cerevisiae) homolog
  • RAD52 homolog (S. cerevisiae)
  • recombination protein RAD52
  • rhabdomyosarcoma antigen MU-RMS-40.23

Background

DNA double-strand breaks are generated by ionizing radiation and endogenously produced radicals, and they often are repaired through the RAD52 homologous recombination pathway. The RAD52 family includes RAD51, RAD52, RAD54, RAD54B and MRE11 genes. Rad51 and Rad52 proteins perform the key steps in homologous recombination (HR), including the search for DNA homology and strand exchange, through similar mechanisms. Mre11 functions in both non-homologous end joining, and meiotic HR, and it is essential in mitosis for chromosome maintenance. Rad54 belongs to the SWI2/SNF2 subfamily of ATPases, which includes the DNA helicases involved in replication, recombination, and repair, as it contains seven amino acid sequence motifs that are largely conserved. Rad54 ATPase activity is dependent on double-stranded (ds) DNA, and the ATPase activity of Rad54 is not absolutely required for its DNA repair function, suggesting that these activities occur at distinct regions of the molecule. RAD54B is significantly homologous to the RAD54 recombination gene. Expression of RAD54B is highest in testis and spleen, which are active in both meiotic and mitotic recombination.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-27500
Species: Mu
Applications: KO, PEP-ELISA, WB
NB100-147
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00005810-M01J
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, ELISA(Cap), S-ELISA, WB
AF1626
Species: Hu
Applications: ICC, WB
MAB2476
Species: Hu
Applications: IHC, WB
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-508
Species: Ha, Hu, Mu, Rt
Applications: ChIP, IP, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NB120-13600
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00056852-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NB100-598
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NBP2-33916
Species: Hu, Mu
Applications: ICC/IF, Simple Western, WB
NBP1-83417
Species: Hu
Applications: IHC, IHC-P
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB

Publications for RAD52 Recombinant Protein Antigen (NBP2-58116PEP) (0)

There are no publications for RAD52 Recombinant Protein Antigen (NBP2-58116PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RAD52 Recombinant Protein Antigen (NBP2-58116PEP) (0)

There are no reviews for RAD52 Recombinant Protein Antigen (NBP2-58116PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RAD52 Recombinant Protein Antigen (NBP2-58116PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RAD52 Products

Array NBP2-58116PEP

Research Areas for RAD52 Recombinant Protein Antigen (NBP2-58116PEP)

Find related products by research area.

Blogs on RAD52

There are no specific blogs for RAD52, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

RAD52 Antibody
NBP2-58116
Rad50 Antibody (13B3)
NB100-147-0.1ml

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our RAD52 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RAD52