![Immunocytochemistry/Immunofluorescence: RAB3GAP2 Antibody [NBP1-84199] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RAB3GAP2-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84199-img0004.jpg "Immunocytochemistry/Immunofluorescence: RAB3GAP2 Antibody [NBP1-84199] - Staining of human cell line U-251 MG shows localization to cytosol. Antibody staining is shown in green.")
| Reactivity | Hu, Pm, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TYEIPRHPGVTEQNEELSILYPAAIVTIDGFSLFQSLRACRNQVAKAAASGNENIQPPPLAYKKWGLQDIDTIIDHASVGIMTLSPFDQMKTA |
| Predicted Species | Mouse (99%), Rat (99%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB3GAP2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB3GAP2 Antibody (NBP1-84199)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB3GAP2 |
![Immunohistochemistry-Paraffin: RAB3GAP2 Antibody [NBP1-84199] -Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/antibody/nbp1-84199_rabbit-polyclonal-rab3gap2-antibody-immunohistochemistry-paraffin-95202495241..jpg "Immunohistochemistry-Paraffin: RAB3GAP2 Antibody [NBP1-84199] -Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: RAB3GAP2 Antibody [NBP1-84199] - Staining of human cerebral cortex shows moderate positivity in neuropil.](http://images.novusbio.com/fullsize/antibody/nbp1-84199_rabbit-polyclonal-rab3gap2-antibody-immunohistochemistry-paraffin-95202495355..jpg "Immunohistochemistry-Paraffin: RAB3GAP2 Antibody [NBP1-84199] - Staining of human cerebral cortex shows moderate positivity in neuropil.")
![Immunohistochemistry-Paraffin: RAB3GAP2 Antibody [NBP1-84199] -Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-84199_rabbit-polyclonal-rab3gap2-antibody-immunohistochemistry-paraffin-95202495454..jpg "Immunohistochemistry-Paraffin: RAB3GAP2 Antibody [NBP1-84199] -Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RAB3GAP2 Antibody [NBP1-84199] -Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp1-84199_rabbit-polyclonal-rab3gap2-antibody-immunohistochemistry-paraffin-9520249562..jpg "Immunohistochemistry-Paraffin: RAB3GAP2 Antibody [NBP1-84199] -Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.")
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_2_AF1730_Immunocytochemistry_6474.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1730_human-integrin-beta-2-cd18-affinity-purified-polyclonal-ab-immunocytochemistry-1292023225343.jpg)
![Western Blot Integrin alpha L/CD11a Antibody (345913) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_L_MAB3595_Western_Blot_10266.jpg)
![Simple Western Integrin alpha L/CD11a Antibody (345913) [Unconjugated]](https://images.novusbio.com/images2/mab3595_human-integrin-alpha-l-cd11a-mab-clone-345913-simple-western-268202215744.jpg)
![Immunohistochemistry ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images2/ICAM1_AF796_Immunohistochemistry_17354.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-4120241048112.jpg)
![Western Blot ICAM-1/CD54 Antibody [Unconjugated]](https://images.novusbio.com/images/af796_mouse-icam-1-cd54-affinity-purified-polyclonal-ab-41202410481112.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")