![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody NBP1-88829 (A) shows similar protein distribution across tissues to independent antibody NBP1-88854 (B).](http://images.novusbio.com/fullsize/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0012.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex, colon, lymph node and testis using Anti-ASCC3 antibody NBP1-88829 (A) shows similar protein distribution across tissues to independent antibody NBP1-88854 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KKFLNEHLQEACTPELKPVEKTNGSFLWCEVEKYLNSTLKEMTEVPRVEDLCCTLYDMLASIKSGDELQDELFELLGPEGLELIEKLLQNRI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ASCC3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Margherita verardo |
WB | Human | 07/13/2020 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for ASCC3 Antibody (NBP1-88829)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ASCC3 |
![Western Blot: ASCC3 Antibody [NBP1-88829] - Western blot analysis of human skeletal muscle cell lysate (right lane). MWM in right lane (kDa). Western blot image submitted by a verified customer review.](http://images.novusbio.com/fullsize/ASCC3-Antibody-Western-Blot-NBP1-88829-img0015.jpg "Western Blot: ASCC3 Antibody [NBP1-88829] - Western blot analysis of human skeletal muscle cell lysate (right lane). MWM in right lane (kDa). Western blot image submitted by a verified customer review.")
![Immunocytochemistry/Immunofluorescence: ASCC3 Antibody [NBP1-88829] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ASCC3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88829-img0006.jpg "Immunocytochemistry/Immunofluorescence: ASCC3 Antibody [NBP1-88829] - Staining of human cell line A-431 shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human colon.](http://images.novusbio.com/fullsize/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0014.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human colon.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0007.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human skeletal muscle shows weak to moderate cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0008.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0009.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0010.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0011.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/ASCC3-Antibody-Immunohistochemistry-Paraffin-NBP1-88829-img0013.jpg "Immunohistochemistry-Paraffin: ASCC3 Antibody [NBP1-88829] - Staining of human cerebral cortex.")
![Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Functional_Assay_15457.jpg)
![Western Blot CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Western_Blot_20204.jpg)
![Simple Western CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/af632_human-cd40-tnfrsf5-affinity-purified-polyclonal-ab-simple-western-58202111562.jpg)
![Western Blot c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/c-Abl_AF5414_Western_Blot_5714.jpg)
![Simple Western c-Abl Antibody [Unconjugated]](https://images.novusbio.com/images2/cAbl_AF5414_Simple_Western_17046.jpg)
![Immunocytochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunocytochemistry__Immunofluorescence_17382.jpg)
![Immunohistochemistry Aminopeptidase N/CD13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Aminopeptidase_N_AF2335_Immunohistochemistry_23316.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
