Procalcitonin Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Procalcitonin Source: E. coli
Amino Acid Sequence: SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
CALCA |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10-100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-16983. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking tide related information and a protocol, click here. |
Theoretical MW |
24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Procalcitonin Recombinant Protein Antigen
Background
Procalcitonin (PCT) is a 116 amino acid residue peptide with molecular weight of about 13 kDa. PCT itself has no known hormonal activity. PCT belongs to a group of related proteins including calcitonin gene-related peptides I and II, amylin, adrenomodulin and calcitonin (CAPA peptide family). PCT, like other peptides of CAPA family, appears from the common precursor pre-procalcitonin consisting of 141 amino acids by removal of 25 amino acids from the N-terminus. PCT undergoes successive cleavages to form three molecules: N-terminal fragment (55 a.a.), calcitonin (32 a.a.) and katacalcin (21 a.a.). Under normal metabolic conditions, PCT is only present in the C cells of the thyroid gland. In bacterial infection and sepsis, however, intact PCT is found in the blood and, more importantly, its level is related to the severity of bacterial sepsis. Today, PCT is considered to be one of the earliest and most specific markers of sepsis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: IHC
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Mu
Applications: ELISA
Species: Hu
Applications: AC
Publications for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP) (0)
There are no publications for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP) (0)
There are no reviews for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP) (0)
Additional Procalcitonin Products
Research Areas for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP)
Find related products by research area.
|
Blogs on Procalcitonin