Novus Biologicals products are now on bio-techne.com

Procalcitonin Recombinant Protein Antigen

Images

 
There are currently no images for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Procalcitonin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Procalcitonin

Source: E. coli

Amino Acid Sequence: SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CALCA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-16983.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Procalcitonin Recombinant Protein Antigen

  • CALC1
  • CALCA
  • Calcitonin 1
  • calcitonin gene-related peptide 1
  • CGRP
  • Katacalcin
  • Procalcitonin

Background

Procalcitonin (PCT) is a 116 amino acid residue peptide with molecular weight of about 13 kDa. PCT itself has no known hormonal activity. PCT belongs to a group of related proteins including calcitonin gene-related peptides I and II, amylin, adrenomodulin and calcitonin (CAPA peptide family). PCT, like other peptides of CAPA family, appears from the common precursor pre-procalcitonin consisting of 141 amino acids by removal of 25 amino acids from the N-terminus. PCT undergoes successive cleavages to form three molecules: N-terminal fragment (55 a.a.), calcitonin (32 a.a.) and katacalcin (21 a.a.). Under normal metabolic conditions, PCT is only present in the C cells of the thyroid gland. In bacterial infection and sepsis, however, intact PCT is found in the blood and, more importantly, its level is related to the severity of bacterial sepsis. Today, PCT is considered to be one of the earliest and most specific markers of sepsis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7665
Species: Hu
Applications: IHC, WB
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP2-46349
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-46535
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
MAB4077
Species: Hu
Applications: IHC, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
DY1707
Species: Hu
Applications: ELISA
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NLS6731
Species: Bv, Ca, Eq, Gt, Ha, Hu, Pm, Po, Pm, Rb, Rt, Xp
Applications: IHC, IHC-P
DCP00
Species: Hu
Applications: ELISA
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-33680
Species: Hu
Applications: IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
DY453
Species: Mu
Applications: ELISA
NBP3-16983PEP
Species: Hu
Applications: AC

Publications for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP) (0)

There are no publications for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP) (0)

There are no reviews for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Procalcitonin Products

Research Areas for Procalcitonin Recombinant Protein Antigen (NBP3-16983PEP)

Find related products by research area.

Blogs on Procalcitonin

There are no specific blogs for Procalcitonin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Procalcitonin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CALCA