![Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/PNMT-Antibody-Immunohistochemistry-Paraffin-NBP2-33602-img0017.jpg "Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKV |
| Predicted Species | Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PNMT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PNMT Antibody (NBP2-33602)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human adrenal gland shows moderate to strong cytoplasmic positivity.](http://images.novusbio.com/fullsize/PNMT-Antibody-Immunohistochemistry-Paraffin-NBP2-33602-img0012.jpg "Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human adrenal gland shows moderate to strong cytoplasmic positivity.")
![Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human adrenal gland, cerebral cortex, liver and pancreas using Anti-PNMT antibody NBP2-33602 (A) shows similar protein distribution across tissues to independent antibody NBP2-33392 (B).](http://images.novusbio.com/fullsize/PNMT-Antibody-Immunohistochemistry-Paraffin-NBP2-33602-img0013.jpg "Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human adrenal gland, cerebral cortex, liver and pancreas using Anti-PNMT antibody NBP2-33602 (A) shows similar protein distribution across tissues to independent antibody NBP2-33392 (B).")
![Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/PNMT-Antibody-Immunohistochemistry-Paraffin-NBP2-33602-img0014.jpg "Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PNMT-Antibody-Immunohistochemistry-Paraffin-NBP2-33602-img0015.jpg "Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining in human adrenal gland and pancreas tissues using NBP2-33602 antibody. Corresponding PNMT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PNMT-Antibody-Immunohistochemistry-Paraffin-NBP2-33602-img0016.jpg "Immunohistochemistry-Paraffin: PNMT Antibody [NBP2-33602] - Staining in human adrenal gland and pancreas tissues using NBP2-33602 antibody. Corresponding PNMT RNA-seq data are presented for the same tissues.")
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![N/A Neutrophil Elastase/ELA2 [Biotin]](https://images.novusbio.com/images2/DATA_Neutrophil_Elastase_DY451705_ELISA_2461.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")