PFDN4 Antibody - Azide and BSA Free Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-134 of human PFDN4 (NP_002614.2). MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PFDN4 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:200 - 1:2000
|
Theoretical MW |
15 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for PFDN4 Antibody - Azide and BSA Free
Background
PFDN4, also known as Prefoldin subunit 4, is a 134 amino acid protein that is 15 kDa, binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it, promotes folding in an environment in which there are many competing pathways for nonnative proteins, and is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. Current research is being performed on this protein involvement in b-cell non-hodgkin lymphoma, non-hodgkin lymphoma, hodgkin's lymphoma, hereditary angioedema, myocardial infarction, sinusitis, gastric cancer, colorectal cancer, breast cancer, cerebritis, cholesterol, and malaria. The PFDN4 has also been shown to have interactions with MAP3K3, ACTB, PRPF4, TUBA3E, PFDN2, and plus 80 other proteins in chaperonin-mediated protein folding, prefoldin mediated transfer of substrate to CCT/TriC, cooperation of Prefoldin and TriC/CCT in actin and tubulin folding, metabolism of proteins, and protein folding pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Pm, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Hu, Mu
Applications: Flow, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for PFDN4 Antibody (NBP2-93935) (0)
There are no publications for PFDN4 Antibody (NBP2-93935).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PFDN4 Antibody (NBP2-93935) (0)
There are no reviews for PFDN4 Antibody (NBP2-93935).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PFDN4 Antibody (NBP2-93935) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PFDN4 Products
Research Areas for PFDN4 Antibody (NBP2-93935)
Find related products by research area.
|
Blogs on PFDN4