![Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human cerebral cortex, hypothalamus, liver and testis using Anti-PMCH antibody NBP2-57697 (A) shows similar protein distribution across tissues to independent antibody NBP2-13780 (B).](http://images.novusbio.com/fullsize/PMCH-Antibody-Immunohistochemistry-Paraffin-NBP2-57697-img0009.jpg "Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human cerebral cortex, hypothalamus, liver and testis using Anti-PMCH antibody NBP2-57697 (A) shows similar protein distribution across tissues to independent antibody NBP2-13780 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KGSVAFPAENGVQNTESTQEKREIGDEENSAKFPIGRRDFDMLRCMLGRVYRPCW |
| Predicted Species | Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PMCH |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western MCHR1 Antibody (851047) [Unconjugated]](https://images.novusbio.com/images2/MCHR1_MAB7938_Simple_Western_17149.jpg)
![Western Blot MCHR1 Antibody (851047) [Unconjugated]](https://images.novusbio.com/images2/MCHR1_MAB7938_Western_Blot_12993.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PMCH Antibody (NBP2-57697)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PMCH |
![Immunohistochemistry: PMCH Antibody [NBP2-57697] - Staining of mouse brain shows strong positivity in of neurons in the hypothalamus.](http://images.novusbio.com/fullsize/PMCH-Antibody-Immunohistochemistry-NBP2-57697-img0001.jpg "Immunohistochemistry: PMCH Antibody [NBP2-57697] - Staining of mouse brain shows strong positivity in of neurons in the hypothalamus.")
![Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/PMCH-Antibody-Immunohistochemistry-Paraffin-NBP2-57697-img0002.jpg "Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/PMCH-Antibody-Immunohistochemistry-Paraffin-NBP2-57697-img0003.jpg "Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human hypothalamus.](http://images.novusbio.com/fullsize/PMCH-Antibody-Immunohistochemistry-Paraffin-NBP2-57697-img0004.jpg "Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human hypothalamus.")
![Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/PMCH-Antibody-Immunohistochemistry-Paraffin-NBP2-57697-img0005.jpg "Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of rat hypothalamus shows strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/PMCH-Antibody-Immunohistochemistry-Paraffin-NBP2-57697-img0006.jpg "Immunohistochemistry-Paraffin: PMCH Antibody [NBP2-57697] - Staining of rat hypothalamus shows strong cytoplasmic positivity in neurons.")
![Immunohistochemistry Orexin A/Hypocretin-1 Antibody (97505) [Unconjugated]](https://images.novusbio.com/images2/mab763_human-mouse-rat-orexin-a-hypocretin-1-mab-clone-97505-immunohistochemistry-30112022115129.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")