Novus Biologicals products are now on bio-techne.com

PI 3-Kinase p85 alpha Antibody (3X3T8)

Images

 
Western Blot: PI 3-Kinase p85 alpha Antibody (7Z9H0) [NBP3-16525] - Western blot analysis of extracts of various cell lines, using PI 3-Kinase p85 alpha Rabbit mAb (NBP3-16525) at 1:1000 dilution. Secondary antibody: ...read more
Mouse brain using PI3 Kinase p85 alpha Rabbit mAb at dilution of 1:60 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Rat brain using PI3 Kinase p85 alpha Rabbit mAb at dilution of 1:60 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clone
3X3T8
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PI 3-Kinase p85 alpha Antibody (3X3T8) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PI 3-Kinase p85 alpha (P27986). MSAEGYQYRALYDYKKEREEDIDLHLGDILTVNKGSLVALGFSDGQEARPEEIGWLNGYNETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPG
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
PIK3R1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for PI 3-Kinase p85 alpha Antibody (3X3T8)

  • AGM7
  • GRB1
  • IMD36
  • p85
  • p85-ALPHA
  • Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha
  • phosphatidylinositol 3-kinase regulatory subunit alpha
  • phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha)
  • phosphatidylinositol 3-kinase-associated p-85 alpha
  • phosphoinositide-3-kinase regulatory subunit alpha
  • phosphoinositide-3-kinase, regulatory subunit 1 (alpha)
  • PI 3Kinase p85 alpha
  • PI 3-Kinase p85 alpha
  • PI3K regulatory subunit alpha
  • PI3-kinase regulatory subunit alpha
  • PI3-kinase subunit p85-alpha
  • PIK3R1
  • PtdIns-3-kinase regulatory subunit alpha
  • PtdIns-3-kinase regulatory subunit p85-alpha

Background

Phosphatidylinositol 3-kinase (PI3K) p85 alpha is a regulatory subunit that heterodimerizes with a catalytic subunit to form a Class IA PI3K enzyme complex, which plays an important role in the immune system (1,2). The P13K pathway is involved in many diverse processes including growth, metabolism, proliferation, and survival (2). PI3Ks are typically activated by cytokine receptors and are responsible for phosphorylation of the 3'-hydroxyl group of PI and its derivatives (3). p85 alpha is one of five regulatory subunit proteins which also includes p55 alpha, p50 alpha, p85 beta, and p55 gamma, and can bind to two of the three catalytic subunits (p110 alpha or p110 delta) (1,2). p85 alpha, p55 alpha, and p50 alpha proteins are all synthesized by the same PIK3R1 gene by alternative splicing (1). Structurally, PI 3-Kinase p85 alpha contains SRC homology 3 (SH3 domain), followed by a Bcr homology (BH) domain flanked by two proline-rich regions, then a N-terminal SH2 domain, an inter-SH2 domain, and C-terminal SH2 domain (1,2). PI 3-Kinase p85 alpha protein consists of 724 amino acids (aa) in length with a theoretical molecular weight of 83.5 kDa (2,4). The primary role for the p85 subunit is interaction with cell surface receptors and acts as an adapter for the stabilization and recruitment of the p110 catalytic subunit to the plasma membrane (1,3). Additionally, p85 has been shown to function in both interleukin-2 receptor (IL2R) and erythropoietin receptor (EpoR) endocytosis (3).

The PI3K pathway functions in a broad range of cellular processes, so it is understandable that pathway dysfunction can lead to an array of diseases and disorders (2,5). Elevated PI3K signaling is a key feature of many cancers (5). PI3K pathway dysregulation has also been implicated in neurological, metabolic, and cardiovascular disorders (5). Furthermore, both overactivation or under-activation of the PI3K delta (p85 alpha subunit + p110 delta subunit) pathway has been shown to cause immunodeficiency and pathologies related to immune system dysfunction (2). Therapeutics to target the PI3K pathway and treat related cancers include PI3K inhibitors and, specifically, isoform-selective inhibitors which have a lot of promise when used as part of a combination therapy (5).

References

1. Okkenhaug, K., & Vanhaesebroeck, B. (2001). New responsibilities for the PI3K regulatory subunit p85 alpha. Science's STKE : signal transduction knowledge environment. https://doi.org/10.1126/stke.2001.65.pe1

2. Nunes-Santos, C. J., Uzel, G., & Rosenzweig, S. D. (2019). PI3K pathway defects leading to immunodeficiency and immune dysregulation. The Journal of allergy and clinical immunology. https://doi.org/10.1016/j.jaci.2019.03.017

3. Chen, P. H., Yao, H., & Huang, L. J. (2017). Cytokine Receptor Endocytosis: New Kinase Activity-Dependent and -Independent Roles of PI3K. Frontiers in endocrinology. https://doi.org/10.3389/fendo.2017.00078

4. Uniprot (P27986)

5. Fruman, D. A., Chiu, H., Hopkins, B. D., Bagrodia, S., Cantley, L. C., & Abraham, R. T. (2017). The PI3K Pathway in Human Disease. Cell. https://doi.org/10.1016/j.cell.2017.07.029

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-82001
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-15071
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
NBP2-19804
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46404
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-74648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3846
Species: Hu, Mu, Rt
Applications: IHC, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
MAB6347
Species: Hu
Applications: WB
236-EG
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
NBP3-16525
Species: Hu, Mu, Rt
Applications: WB, IHC

Publications for PI 3-Kinase p85 alpha Antibody (NBP3-16525) (0)

There are no publications for PI 3-Kinase p85 alpha Antibody (NBP3-16525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p85 alpha Antibody (NBP3-16525) (0)

There are no reviews for PI 3-Kinase p85 alpha Antibody (NBP3-16525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PI 3-Kinase p85 alpha Antibody (NBP3-16525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PI 3-Kinase p85 alpha Products

Research Areas for PI 3-Kinase p85 alpha Antibody (NBP3-16525)

Find related products by research area.

Blogs on PI 3-Kinase p85 alpha

There are no specific blogs for PI 3-Kinase p85 alpha, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PI 3-Kinase p85 alpha Antibody (3X3T8) and receive a gift card or discount.

Bioinformatics

Gene Symbol PIK3R1