Home » PI 3-Kinase p110 delta » PI 3-Kinase p110 delta Antibodies » PI 3-Kinase p110 delta Antibody
Novus Biologicals products are now on bio-techne.com

PI 3-Kinase p110 delta Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Analysis in human lymph node and skeletal muscle tissues using NBP2-38535 antibody. Corresponding PIK3CD RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Analysis in human lymph node and skeletal muscle tissues using NBP2-38535 antibody. Corresponding PIK3CD ...read more
Western Blot: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Lane 1: Marker [kDa] 250,130,100,70,55,35,25,15,10. Lane 2: Human tonsil tissue
Immunocytochemistry/ Immunofluorescence: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytokinetic bridge & vesicles.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human lymph node shows high expression.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: PI 3-Kinase p110 delta Antibody [NBP2-38535] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

  

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PI 3-Kinase p110 delta Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PIK3CD
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PI 3-Kinase p110 delta Protein (NBP2-38535PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PI 3-Kinase p110 delta Antibody

  • EC 2.7.1
  • EC 2.7.1.153
  • p110D
  • P110DELTA
  • Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta
  • phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  • phosphoinositide-3-kinase C
  • phosphoinositide-3-kinase, catalytic, delta polypeptide
  • PI 3Kinase p110 delta
  • PI 3-Kinase p110 delta
  • PI3K
  • PI3K-delta
  • PI3-kinase p110 subunit delta
  • PI3-kinase subunit delta
  • PIK3CD
  • PtdIns-3-kinase subunit delta
  • PtdIns-3-kinase subunit p110-delta

Background

PI3-Kinases (PI3-Ks) are a family of lipid kinases that are implicated in signal transduction. PI3-K consists of two subunits; p85 and p110. The p85 subunit localize PI3-K activity to the plasma membrane while the p110 subunit contains the catalytic domain of PI3-K. Four isoforms of p110 has been found; the alpha, beta, gamma, and the delta subunit. The delta isoform is predominantly expressed in leukocytes and has been shown to interact with p85 and GTP-bound Ras via its SH2/SH3 domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(62 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
PTEN Antibody
[Unconjugated]
AF847
Western Blot PTEN Antibody [Unconjugated]
Simple Western PTEN Antibody [Unconjugated]
Knockout Validated PTEN Antibody [Unconjugated]
(15 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(680 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(221 Publications)
Species: Hu
Applications: BA
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(821 Publications)
Species: Hu
Applications: BA
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(385 Publications)
Species: Hu, Mu
Applications: ICC, IHC
PI 3-Kinase p110
delta Antibody
NBP2-38535
PI 3-Kinase p110 delta Antibody
Species: Hu
Applications: WB, ICC/IF, IHC

Publications for PI 3-Kinase p110 delta Antibody (NBP2-38535) (0)

There are no publications for PI 3-Kinase p110 delta Antibody (NBP2-38535).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PI 3-Kinase p110 delta Antibody (NBP2-38535) (0)

There are no reviews for PI 3-Kinase p110 delta Antibody (NBP2-38535). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PI 3-Kinase p110 delta Antibody (NBP2-38535) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PI 3-Kinase p110 delta Products

Research Areas for PI 3-Kinase p110 delta Antibody (NBP2-38535)

Find related products by research area.

Blogs on PI 3-Kinase p110 delta.

Check out the latest blog posts on PI 3-Kinase p110 delta.
PI3 Kinase p110 delta - A cell-type specific lipid kinase with essential roles in leukocyte biology
Phosphatidylinositol 3-kinases (PI3Ks) are a group of lipid kinases with important roles in signal transduction. PI3Ks are involved in signal propagation for diverse receptors including tyrosine kinase receptors and G-protein coupled receptors. Cla...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PI 3-Kinase p110 delta Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PIK3CD