Home » Peptidylglycine alpha-Amidating Monooxygenase/PAM » PAM Antibodies » Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody
Novus Biologicals products are now on bio-techne.com

Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PAM Antibody [NBP1-69318] - This Anti-PAM antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.
Western Blot: PAM Antibody [NBP1-69318] - This Anti-PAM antibody was used in Western Blot of 721_B tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody Summary

Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptides corresponding to PAM(peptidylglycine alpha-amidating monooxygenase) The peptide sequence was selected from the N terminal of PAM. Peptide sequence PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PAM
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
108 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody

  • PAL
  • PAM
  • pancreatic peptidylglycine alpha-amidating monooxygenase
  • peptidyl alpha-amidating enzyme
  • peptidyl-alpha-hydroxyglycine alpha-amidating lyase
  • peptidylamidoglycolate lyase
  • peptidylglycine 2-hydroxylase
  • peptidyl-glycine alpha-amidating monooxygenase
  • peptidylglycine alpha-amidating monooxygenase
  • peptidylglycine alpha-hydroxylating monooxygenase
  • PHM

Background

PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.This gene encodes a multifunctional protein. It has two enzymatically active domains with catalytic activities - peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene but some of their full length sequences are not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TLR2 Antibody
(TL2.1) - BSA Free
NB100-56722
Flow (Cell Surface) TLR2 Antibody (TL2.1) - BSA Free
Flow Cytometry TLR2 Antibody (TL2.1) - BSA Free
Block/ Neutralize TLR2 Antibody (TL2.1) - BSA Free
(64 Publications)
Species: Ca, Hu, Mu, Rb, Rt
Applications: B/N, DB, ELISA, Flow-CS, Flow, Func, ICC/IF, IP, In vitro, WB
VIP Antibody
(OTI1E8)
NBP2-46349
Immunohistochemistry VIP Antibody (OTI1E8)
Immunohistochemistry VIP Antibody (OTI1E8)
Immunohistochemistry VIP Antibody (OTI1E8)
Species: Hu
Applications: IHC, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(140 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(643 Publications)
Species: Mu
Applications: ELISA
CSK Antibody
NBP1-85951
Immunocytochemistry/ Immunofluorescence CSK Antibody
Western Blot CSK Antibody
Western Blot CSK Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Dopamine
beta-Hydroxylase Anti
NBP1-31386
Unknown Dopamine beta-Hydroxylase Antibody
Western Blot Dopamine beta-Hydroxylase Antibody
Immunohistochemistry-Paraffin Dopamine beta-Hydroxylase Antibody
(5 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Substance P
Antibody (266815)
MAB4375
Immunohistochemistry Substance P Antibody (266815)
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC
Carboxypeptidase
E/CPE Antibody [Uncon ...
AF3587
Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]
Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]
Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ICC, IHC, IP, ICFlow, WB
HPD Antibody
NBP1-89366
Western Blot HPD Antibody
Western Blot HPD Antibody
Immunohistochemistry-Paraffin HPD Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
VSX1 Antibody
NBP3-25228
Immunocytochemistry/ Immunofluorescence VSX1 Antibody
Species: Hu
Applications: ICC/IF
TLR1 Antibody
NB100-56563
Flow Cytometry TLR1 Antibody
Flow Cytometry TLR1 Antibody
Western Blot TLR1 Antibody
(13 Publications)
Species: Hu, Mu, Rt
Applications: DB, Flow-CS, Flow-IC, Flow, IHC, IHC-P, WB
Recombinant Human
LYST GST (N-Term) Pro ...
H00001130-Q01
Other Recombinant Human LYST GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Procalcitonin
Antibody (44D9)
NB120-14817
Procalcitonin Antibody (44D9)
(1 Review)
(11 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB

Publications for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318) (0)

There are no publications for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318) (0)

There are no reviews for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318). (Showing 1 - 2 of 2 FAQ).

  1. I'm looking for a polyclonal antibody for Peptidyl-glycine alpha-amidating monooxygenase (PAM) that works in mouse and for immune-fluorescence experiments. I found the following product on your website: NBP1-62288 but the specificity is towards human and has only been tested for western blot. Could I use this antibody for my studies? If not, would you know/have an other antibody that would suit my needs?
    • NBP1-62288 is now sold as catalogue number NBP1-69318. Please accept my apologies for any confusion which may have been caused by this change. As you rightly point out, this rabbit polyclonal antibody has been validated for Western blotting with samples from mouse, but has not yet been tested in immunofluorescence. Should you wish to try this antibody for immunofluorescence I can highly recommend our Innovator's Reward Program. This allows you to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply need to go to the antibody’s webpage and complete an online review with an image, detailing the positive or negative results of your study. In return you will receive a discount voucher for 100% of the purchase price of the reviewed product.
  2. Do you provide samples for testing these in new applications? Many companies, recognizing the benefit to their business of extending applications to new species (as well as the risk taken by research teams to test expensive antibodies in new applications), will provide a small, free sample for this purpose. Please let me know.
    • We unfortunately do not provide free samples, but we do offer our Innovator's Reward Program for untested applications or species. Our Innovator’s Reward™ program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. Submit an online review detailing your results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product to use in a future purchase of your choice.

Secondary Antibodies

 

Isotype Controls

Additional Peptidylglycine alpha-Amidating Monooxygenase/PAM Products

Research Areas for Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody (NBP1-69318)

Find related products by research area.

Blogs on Peptidylglycine alpha-Amidating Monooxygenase/PAM

There are no specific blogs for Peptidylglycine alpha-Amidating Monooxygenase/PAM, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Peptidylglycine alpha-Amidating Monooxygenase/PAM Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PAM
Uniprot