![Western Blot: CSK Antibody [NBP1-85951] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/CSK-Antibody-Western-Blot-NBP1-85951-img0011.jpg "Western Blot: CSK Antibody [NBP1-85951] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: WSFGILLWEIYSFGRVPYPRIPLKDVVPRVEKGYKMDAPDGCPPAVYEVMKNCWHLDAAMRPSFLQLREQLEHIKTHELH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CSK |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Publication using NBP1-85951 | Applications | Species |
|---|---|---|
| Gallagher SJ, Rambow F, Kumasaka M et al. Beta-catenin inhibits melanocyte migration but induces melanoma metastasis. Oncogene 2013-04-25 [PMID: 22665063] |
Secondary Antibodies |
Isotype Controls |
Research Areas for CSK Antibody (NBP1-85951)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CSK |
![Immunocytochemistry/Immunofluorescence: CSK Antibody [NBP1-85951] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.](http://images.novusbio.com/fullsize/CSK-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85951-img0009.jpg "Immunocytochemistry/Immunofluorescence: CSK Antibody [NBP1-85951] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & vesicles.")
![Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human duodenum shows weak to moderate cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/CSK-Antibody-Immunohistochemistry-Paraffin-NBP1-85951-img0013.jpg "Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human duodenum shows weak to moderate cytoplasmic positivity in lymphoid cells.")
![Western Blot: CSK Antibody [NBP1-85951] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/CSK-Antibody-Western-Blot-NBP1-85951-img0006.jpg "Western Blot: CSK Antibody [NBP1-85951] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Western Blot: CSK Antibody [NBP1-85951] - Analysis in human cell line RT-4 and human cell line HeLa.](http://images.novusbio.com/fullsize/CSK-Antibody-Western-Blot-NBP1-85951-img0010.jpg "Western Blot: CSK Antibody [NBP1-85951] - Analysis in human cell line RT-4 and human cell line HeLa.")
![Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.](http://images.novusbio.com/fullsize/CSK-Antibody-Immunohistochemistry-Paraffin-NBP1-85951-img0008.jpg "Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human tonsil shows moderate cytoplasmic positivity in non-germinal center cells.")
![Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells and cells in granular layer.](http://images.novusbio.com/fullsize/CSK-Antibody-Immunohistochemistry-Paraffin-NBP1-85951-img0012.jpg "Immunohistochemistry-Paraffin: CSK Antibody [NBP1-85951] - Staining of human cerebellum shows weak to moderate cytoplasmic positivity in Purkinje cells and cells in granular layer.")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Immunohistochemistry FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Immunohistochemistry_6835.jpg)
![Knockout Validated FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/FAK_AF4467_Knockout_Validated_22783.jpg)
![Western Blot FAK Antibody [Unconjugated]](https://images.novusbio.com/images2/af4467_human-mouse-rat-fak-affinity-purified-polyclonal-ab-western-blot-116202015471.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry Lck [p Tyr394] Antibody (755103)](https://images.novusbio.com/images2/Lck_MAB7500_Immunocytochemistry_12319.jpg)
![Western Blot Lck [p Tyr394] Antibody (755103)](https://images.novusbio.com/images2/Lck_MAB7500_Western_Blot_12455.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Western_Blot_5256.jpg)
![Simple Western Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Simple_Western_21252.jpg)
![Immunocytochemistry Lyn Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyn_AF3206_Immunocytochemistry_9784.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Immunocytochemistry Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Immunocytochemistry_10249.jpg)
![Western Blot Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Western_Blot_5429.jpg)
![Simple Western Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Simple_Western_17510.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")