![Immunocytochemistry/Immunofluorescence: PDCD10 Antibody [NBP2-93073] - Immunofluorescence analysis of PC-12 cells using PDCD10 Rabbit pAb (NBP2-93073) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PDCD10-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93073-img0008.jpg "Immunocytochemistry/Immunofluorescence: PDCD10 Antibody [NBP2-93073] - Immunofluorescence analysis of PC-12 cells using PDCD10 Rabbit pAb (NBP2-93073) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-212 of human PDCD10 (NP_009148.2). MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDCD10 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Neutralization VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Block_Neutralize_1519.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_22159.jpg)
![Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/VEGF_R2_AF644_Immunohistochemistry_6888.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PDCD10 Antibody (NBP2-93073)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PDCD10 |
![Immunohistochemistry-Paraffin: PDCD10 Antibody [NBP2-93073] - Paraffin-embedded rat spleen using PDCD10 .](http://images.novusbio.com/fullsize/PDCD10-Antibody-Immunohistochemistry-Paraffin-NBP2-93073-img0007.jpg "Immunohistochemistry-Paraffin: PDCD10 Antibody [NBP2-93073] - Paraffin-embedded rat spleen using PDCD10 .")
![Immunohistochemistry-Paraffin: PDCD10 Antibody [NBP2-93073] - Paraffin-embedded human breast cancer using PDCD10 .](http://images.novusbio.com/fullsize/PDCD10-Antibody-Immunohistochemistry-Paraffin-NBP2-93073-img0002.jpg "Immunohistochemistry-Paraffin: PDCD10 Antibody [NBP2-93073] - Paraffin-embedded human breast cancer using PDCD10 .")
![Immunohistochemistry-Paraffin: PDCD10 Antibody [NBP2-93073] - Paraffin-embedded mouse kidney using PDCD10 .](http://images.novusbio.com/fullsize/PDCD10-Antibody-Immunohistochemistry-Paraffin-NBP2-93073-img0006.jpg "Immunohistochemistry-Paraffin: PDCD10 Antibody [NBP2-93073] - Paraffin-embedded mouse kidney using PDCD10 .")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![Immunocytochemistry Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Immunocytochemistry_10249.jpg)
![Western Blot Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Western_Blot_5429.jpg)
![Simple Western Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Simple_Western_17510.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")