![Immunohistochemistry-Paraffin: p40 Antibody [NBP1-88737] - p40 (p63 delta) Antibody [NBP1-88737] - Staining in human cerebral cortex and skeletal muscle tissues using anti-RABEPK antibody. Corresponding RABEPK RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/p40-p63-delta-Antibody-Immunohistochemistry-Paraffin-NBP1-88737-img0008.jpg "Immunohistochemistry-Paraffin: p40 Antibody [NBP1-88737] - p40 (p63 delta) Antibody [NBP1-88737] - Staining in human cerebral cortex and skeletal muscle tissues using anti-RABEPK antibody. Corresponding RABEPK RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NCLQVLNPETRTWTTPEVTSPPPSPRTFHTSSAAIGNQLYVFGGGERGAQPVQDTKLHVFDANTLTWSQPETLGNPPSPRH |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RABEPK |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Simple_Western_16530.jpg)
![Western Blot GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Western_Blot_13066.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for p40 Antibody (NBP1-88737)Find related products by research area.
|
|
Transportin 1 and heterogeneous nuclear ribonucleoprotein D (hnRNPD) Transportin 1, also known as Karyopherin- beta 2 or Importin- beta 2, is part of the beta -karyopherins family, which consists of importins and exportins responsible for the active transport of proteins between the nucleus and cytoplasm. Transportin 1 is co... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RABEPK |
![Immunohistochemistry-Paraffin: p40 (p63 delta) Antibody [NBP1-88737] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/p40-p63-delta-Antibody-Immunohistochemistry-Paraffin-NBP1-88737-img0007.jpg "Immunohistochemistry-Paraffin: p40 (p63 delta) Antibody [NBP1-88737] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: p40 (p63 delta) Antibody [NBP1-88737] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/p40-p63-delta-Antibody-Immunohistochemistry-Paraffin-NBP1-88737-img0006.jpg "Immunohistochemistry-Paraffin: p40 (p63 delta) Antibody [NBP1-88737] - Staining of human cerebral cortex shows high expression.")
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_403.jpg)
![Bioactivity IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_405.jpg)
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![N/A IL-37/IL-1F7 [Biotin]](https://images.novusbio.com/images2/DATA_IL37_DY1975_ELISA_1742.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")