![Immunocytochemistry/Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Uroplakin-IIIB-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92564-img0006.jpg "Immunocytochemistry/Immunofluorescence: Uroplakin IIIB Antibody [NBP1-92564] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus & vesicles. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELVPYTPQITAWDLEGKVTATTFSLEQPRCVFDGLASASDTVWLVVA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UPK3B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Uroplakin IIIB antibody validated for IHC from a verified customer review. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Peter Caradonna |
IHC | Human | 04/03/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Uroplakin IIIB Antibody (NBP1-92564)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UPK3B |
![Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Uroplakin-IIIB-Antibody-Immunohistochemistry-Paraffin-NBP1-92564-img0010.jpg "Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564] - IHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was applied for 1 hour RT, then visualized with DAB. HIER was conducted using citrate buffer pH 6.0 at 95 C for 15 minutes. Incubation of primary antibody with immunogenic peptide shows no staining in adjacent control section. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Uroplakin-IIIB-Antibody-Immunohistochemistry-NBP1-92564-img0005.jpg "Immunohistochemistry: Uroplakin IIIB Antibody [NBP1-92564] - IHC using NBP1-92564 at a dilution of 1:300 on FFPE human placenta. Primary antibody was applied overnight at 4 C. HRP conjugated secondary antibody was applied for 1 hour RT, then visualized with DAB. HIER was conducted using citrate buffer pH 6.0 at 95 C for 15 minutes. Incubation of primary antibody with immunogenic peptide shows no staining in adjacent control section. Image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human urninary bladder shws strong postivity in apical membrane in urothelial cells.](http://images.novusbio.com/fullsize/Uroplakin-IIIB-Antibody-Immunohistochemistry-Paraffin-NBP1-92564-img0007.jpg "Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human urninary bladder shws strong postivity in apical membrane in urothelial cells.")
![Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human lung shows moderate membranous and cytoplasmic psotivity in macrophages.](http://images.novusbio.com/fullsize/Uroplakin-IIIB-Antibody-Immunohistochemistry-Paraffin-NBP1-92564-img0008.jpg "Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human lung shows moderate membranous and cytoplasmic psotivity in macrophages.")
![Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/Uroplakin-IIIB-Antibody-Immunohistochemistry-Paraffin-NBP1-92564-img0009.jpg "Immunohistochemistry-Paraffin: Uroplakin IIIB Antibody [NBP1-92564] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
