![Immunohistochemistry-Paraffin: P2X3/P2RX3 Antibody [NBP2-33848] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/P2X3-P2RX3-Antibody-Immunohistochemistry-Paraffin-NBP2-33848-img0008.jpg "Immunohistochemistry-Paraffin: P2X3/P2RX3 Antibody [NBP2-33848] - Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FNFEKGNLLPNLTARDMKTCRFHPDKDPFCPILRVGDVVKFAGQDFAKLARTGGVLGIKIGWVCDLDKAWDQCIPKY |
| Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | P2RX3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/EN-RAGE_AF1052_Immunohistochemistry_6671.jpg)
![Western Blot EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/ENRAGE_AF1052_Western_Blot_19098.jpg)
![Simple Western EN-RAGE/S100A12 Antibody [Unconjugated]](https://images.novusbio.com/images2/af1052_human-en-rage-affinity-purified-polyclonal-ab-simple-western-2672021152820.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for P2X3/P2RX3 Antibody (NBP2-33848)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: P2X3/P2RX3 Antibody [NBP2-33848] - Staining of human liver shows no positivity in hepatocytes.](http://images.novusbio.com/fullsize/P2X3-P2RX3-Antibody-Immunohistochemistry-Paraffin-NBP2-33848-img0006.jpg "Immunohistochemistry-Paraffin: P2X3/P2RX3 Antibody [NBP2-33848] - Staining of human liver shows no positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: P2X3/P2RX3 Antibody [NBP2-33848] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/P2X3-P2RX3-Antibody-Immunohistochemistry-Paraffin-NBP2-33848-img0007.jpg "Immunohistochemistry-Paraffin: P2X3/P2RX3 Antibody [NBP2-33848] - Staining of human pancreas shows moderate membranous positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: P2X3/P2RX3 Antibody [NBP2-33848] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/P2X3-P2RX3-Antibody-Immunohistochemistry-Paraffin-NBP2-33848-img0009.jpg "Immunohistochemistry-Paraffin: P2X3/P2RX3 Antibody [NBP2-33848] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")