Orexin R1/HCRTR1 Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human HCRTR1 (NP_001516.2). HPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGT |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
HCRTR1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunohistochemistry
- Western Blot 1:500 - 1:1000
|
Theoretical MW |
47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for Orexin R1/HCRTR1 Antibody - Azide and BSA Free
Background
HCRTR1, or orexin 1 receptor (OX1R), is a G-protein coupled receptor expressed in the hypothalamus and involved in the regulation of feeding behaviour. HCRTR1 selectively binds the orexin A neuropeptide. It shares 64% identity with HCRTR2. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for Orexin R1/HCRTR1 Antibody (NBP2-95106) (0)
There are no publications for Orexin R1/HCRTR1 Antibody (NBP2-95106).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Orexin R1/HCRTR1 Antibody (NBP2-95106) (0)
There are no reviews for Orexin R1/HCRTR1 Antibody (NBP2-95106).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Orexin R1/HCRTR1 Antibody (NBP2-95106) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Orexin R1/HCRTR1 Products
Research Areas for Orexin R1/HCRTR1 Antibody (NBP2-95106)
Find related products by research area.
|
Blogs on Orexin R1/HCRTR1