![Western Blot: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Analysis of HCRTR2 expression in transfected 293T cell line by HCRTR2 monoclonal antibody (M01), clone 1E3.Lane 1: HCRTR2 transfected lysate(50.7 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/Orexin-R2-HCRTR2-Antibody-1E3-Western-Blot-H00003062-M01-img0006.jpg "Western Blot: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Analysis of HCRTR2 expression in transfected 293T cell line by HCRTR2 monoclonal antibody (M01), clone 1E3.Lane 1: HCRTR2 transfected lysate(50.7 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, KD |
| Clone | 1E3 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | HCRTR2 (NP_001517, 1 a.a. ~ 54 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE |
| Localization | Isoform 1 and isoform 4: Cell membrane; single pass type I membrane protein. Isoform 2 and isoform 3: Secreted protein. |
| Specificity | HCRTR2 - hypocretin (orexin) receptor 2 |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | HCRTR2 |
| Purity | Ascites |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against recombinant protein for WB. It has been used for RNAi Validation and ELISA. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Ascites |
| Publication using H00003062-M01 | Applications | Species |
|---|---|---|
| Wang D, Ren H, Li C et al. Orexin A prevents degradation of the articular matrixes in human primary chondrocyte culture Mol Immunol. [PMID: 29913390] (WB, Human) | WB | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 06/08/2011 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Orexin R2/HCRTR2 Antibody (H00003062-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Analysis of HCRTR2 over-expressed 293 cell line, cotransfected with HCRTR2 Validated Chimera RNAi ( Cat # H00003062-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HCRTR2 monoclonal antibody (M01), clone 1E3 (Cat # H00003062-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/Orexin-R2-HCRTR2-Antibody-1E3-Western-Blot-H00003062-M01-img0004.jpg "Western Blot: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Analysis of HCRTR2 over-expressed 293 cell line, cotransfected with HCRTR2 Validated Chimera RNAi ( Cat # H00003062-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HCRTR2 monoclonal antibody (M01), clone 1E3 (Cat # H00003062-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![ELISA: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Detection limit for recombinant GST tagged HCRTR2 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Orexin-R2-HCRTR2-Antibody-1E3-ELISA-H00003062-M01-img0005.jpg "ELISA: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Detection limit for recombinant GST tagged HCRTR2 is approximately 0.03ng/ml as a capture antibody.")
![Immunohistochemistry Orexin A/Hypocretin-1 Antibody (97505) [Unconjugated]](https://images.novusbio.com/images2/mab763_human-mouse-rat-orexin-a-hypocretin-1-mab-clone-97505-immunohistochemistry-30112022115129.jpg)
![Immunocytochemistry CD200R1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD200_R1_AF2554_Immunocytochemistry__Immunofluorescence_17385.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")
![Recombinant Human Orexin R2/HCRTR2 Protein [H00003062-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](https://images.novusbio.com/images/qc_test-H00003062-Q01-1.jpg "Recombinant Human Orexin R2/HCRTR2 Protein [H00003062-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.")
