I'm looking for a Niemann-Pick type1 or 2 antibody to stain mouse heart section embedded in paraffin. I would like to label these sections with another primary antibody to show colocalisation of my protein of interest. I would like to know if you have a rabbit anti-Niemann-Pick antibody that works well for fluorescence immunohistochemistry?

Name: Niemann-Pick C1 Antibody (4H2)
Brand: Novus Biologicals
SKU: H00004864-M02
Price: 499 USD

Question

Accepted Answer

Niemann-Pick C1 Antibody (NB400-148) (0.1 ml) is one of our best sellers and this antibody has been cited in at least 17 peer reviewed research publications in journals of high repute. We have only one Niemann-Pick type C2 antibody with catalog # H00010577-D01P, but this antibody is yet to be established for IHC application. However, if you would like to try this antibody for IHC-P application you would qualify for our Innovators Reward program. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product. Read more about Innovators Reward Program.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, ELISA
Clone	4H2
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Description	Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen	NPC1 (AAH63302, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GFANAMYNACRDVEAPSSNDKALGLLCGKDADACNATNWIEYMFNKDNGQAPFTITPVFSDFPVHGMEPMNNATKGCDESVDEVTAPCSCQDCSIVCGPK
Localization	Late endosome and Lysosome membrane; Single-pass membrane protein.
Specificity	NPC1 - Niemann-Pick disease, type C1
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	NPC1
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Publications using H00004864-M02	Applications	Species
Lund RR, Leth-Larsen R, Caterino TD et al. NADH-cytochrome b5 reductase 3 promotes colonization and metastasis formation and is a prognostic marker of disease-free and overall survival in estrogen receptor-negative breast cancer. Mol Cell Proteomics. 2015-09-08 [PMID: 26351264]
Erwood S, Brewer RA, Bily TMI et al. Modelling Niemann-Pick disease type C in a human haploid cell line allows for patient variant characterization and clinical interpretation bioRxiv
Tang Y, Leao IC, Coleman EM et al. Deficiency of niemann-pick type C-1 protein impairs release of human immunodeficiency virus type 1 and results in Gag accumulation in late endosomal/lysosomal compartments. J Virol 2009-08-01 [PMID: 19474101]
Erwood, S; Applying Precision Genome Editing Technologies to Variant Effect Interpretation Thesis
Erwood, S; Applying Precision Genome Editing Technologies to Variant Effect Interpretation Nat Biotechnol 2022-02-15 [PMID: 35165384]
Erwood S, Brewer RA, Bily TMI et al. Modelling Niemann-Pick disease type C in a human haploid cell line allows for patient variant characterization and clinical interpretation Genome Res 2019-11-23 [PMID: 31754021]

Niemann-Pick C1 Antibody (4H2)

Species Glossary

Images

Product Details

Order Details

Niemann-Pick C1 Antibody (4H2) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Niemann-Pick C1 Antibody (4H2)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Niemann-Pick C1 Antibody (H00004864-M02)(6)

Reviews for Niemann-Pick C1 Antibody (H00004864-M02) (0)

Product General Protocols

Video Protocols

FAQs for Niemann-Pick C1 Antibody (H00004864-M02). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional Niemann-Pick C1 Products

Research Areas for Niemann-Pick C1 Antibody (H00004864-M02)

Blogs on Niemann-Pick C1.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	NPC1
Entrez	4864(Human)
OMIM	257220(Human)
Uniprot	AAH63302(Human)