![Western Blot: AGFG2 Antibody [NBP1-83213] - Analysis in control (vector only transfected HEK293T lysate) and AGFG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/AGFG2-Antibody-Western-Blot-NBP1-83213-img0010.jpg "Western Blot: AGFG2 Antibody [NBP1-83213] - Analysis in control (vector only transfected HEK293T lysate) and AGFG2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGAFTNPFTAPAAQSPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAPLFPPQTPLVQQQNGSSFGDLGSAKLGQRPLSQPAGISTNPFMTGPSSSPFASKPPTTN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AGFG2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 49 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
|
Niemann Pick-C1 and cholesterol dynamics Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis. Although cholesterol moves freely inside the cell, it cannot independently expo... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining in human salivary gland and skeletal muscle tissues using anti-AGFG2 antibody. Corresponding AGFG2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/AGFG2-Antibody-Immunohistochemistry-Paraffin-NBP1-83213-img0009.jpg "Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining in human salivary gland and skeletal muscle tissues using anti-AGFG2 antibody. Corresponding AGFG2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.](http://images.novusbio.com/fullsize/AGFG2-Antibody-Immunohistochemistry-Paraffin-NBP1-83213-img0006.jpg "Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human salivary gland shows high expression.](http://images.novusbio.com/fullsize/AGFG2-Antibody-Immunohistochemistry-Paraffin-NBP1-83213-img0007.jpg "Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human salivary gland shows high expression.")
![Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/AGFG2-Antibody-Immunohistochemistry-Paraffin-NBP1-83213-img0008.jpg "Immunohistochemistry-Paraffin: AGFG2 Antibody [NBP1-83213] - Staining of human skeletal muscle shows low expression as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")