Home » N-Acetylgalactosamine-6-Sulfatase/GALNS » GALNS Peptides and Proteins » N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen (NBP2-62607PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GALNS.

Source: E. coli

Amino Acid Sequence: TTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GALNS
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62607.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen

  • Chondroitinase
  • Chondroitinsulfatase
  • EC 3.1.6
  • EC 3.1.6.4
  • FLJ17434
  • FLJ42844
  • FLJ98217
  • GA6S
  • galactosamine (N-acetyl)-6-sulfate sulfatase
  • Galactose-6-Sulfate Sulfatase
  • GalNAc6S Sulfatase
  • GALNAC6S
  • GALNS
  • GAS
  • MPS4A
  • NAcetylgalactosamine6Sulfatase
  • N-Acetylgalactosamine-6-Sulfatase
  • N-acetylgalactosamine-6-sulfate sulfatase

Background

GALNS encodes N-acetylgalactosamine-6-sulfatase which is a lysosomal exohydrolase required for the degradation of the glycosaminoglycans, keratan sulfate, and chondroitin 6-sulfate. Sequence alterations including point, missense and nonsense mutations, as well as those that affect splicing, result in a deficiency of this enzyme. Deficiencies of this enzyme lead to Morquio A syndrome, a lysosomal storage disorder. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ABCB6 Antibody
NBP1-91642
Immunohistochemistry-Paraffin ABCB6 Antibody
Immunocytochemistry/ Immunofluorescence ABCB6 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ASAH1 Antibody
NBP1-89296
Immunohistochemistry-Paraffin ASAH1 Antibody
Immunohistochemistry-Paraffin ASAH1 Antibody
Immunohistochemistry-Paraffin ASAH1 Antibody
(7 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
CS Citrate
Synthase Antibody (17
NBP2-43648
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
Western Blot CS Citrate Synthase Antibody (1761)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
STAT1 [p Tyr701]
Antibody [Unconjugate ...
AF2894
Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]
Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Decorin Antibody
[Unconjugated]
AF143
Western Blot Decorin Antibody [Unconjugated]
Simple Western Decorin Antibody [Unconjugated]
Immunohistochemistry Decorin Antibody [Unconjugated]
(27 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(446 Publications)
Species: Hu
Applications: BA
IRF1 Antibody
AF4715
Western Blot IRF1 Antibody
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
Aggrecan
Neoepitope Antibody -
NB100-74350
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Western Blot Aggrecan Neoepitope Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Aggrecan Neoepitope Antibody - BSA Free
(32 Publications)
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
CD44 Antibody
(2C5) [Unconjugated] ...
BBA10
Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific
(5 Reviews)
(49 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
DHPS Antibody
NBP1-82648
Immunocytochemistry/ Immunofluorescence DHPS Antibody
Western Blot DHPS Antibody
Immunohistochemistry-Paraffin DHPS Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Peripherin 2/PRPH2
Antibody
NBP1-86687
Western Blot Peripherin 2/PRPH2 Antibody
Immunohistochemistry-Paraffin Peripherin 2/PRPH2 Antibody
Immunohistochemistry-Paraffin Peripherin 2/PRPH2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Dehydrodolichyl
Diphosphate Synthase ...
NBP1-87964
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
Immunohistochemistry-Paraffin Dehydrodolichyl Diphosphate Synthase Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
STAT5a/b Antibody
[Unconjugated] - Pan ...
AF2168
Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific
Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific
Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific
(28 Publications)
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Versican Antibody
[Unconjugated] - Isof ...
AF3054
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0
Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0
(8 Publications)
Species: Hu
Applications: ICC, IHC, WB
Muscarinic
Acetylcholine Recepto ...
NBP1-87466
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
Immunocytochemistry/ Immunofluorescence Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Plasminogen
Antibody
NB600-930
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: ELISA, WB
STAT5b Antibody
[Unconjugated]
AF1584
Western Blot STAT5b Antibody [Unconjugated]
Simple Western STAT5b Antibody [Unconjugated]
Knockout Validated STAT5b Antibody [Unconjugated]
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB

N-Acetylgalactosamine- ...
NBP2-62607PEP
N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen (NBP2-62607PEP) (0)

There are no publications for N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen (NBP2-62607PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen (NBP2-62607PEP) (0)

There are no reviews for N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen (NBP2-62607PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen (NBP2-62607PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional N-Acetylgalactosamine-6-Sulfatase/GALNS Products

Blogs on N-Acetylgalactosamine-6-Sulfatase/GALNS

There are no specific blogs for N-Acetylgalactosamine-6-Sulfatase/GALNS, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Recombinant Human IFN-gamma (Catalog # 285‑IF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The activity is over 2-fold greater than the top competitor's IFN-gamma .
IFN-gamma [Unconjugated]
285-IF-100

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our N-Acetylgalactosamine-6-Sulfatase/GALNS Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GALNS