![Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Analysis in human heart muscle and prostate tissues. Corresponding MyBPC3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MyBPC3-Antibody-Immunohistochemistry-Paraffin-NBP2-13631-img0011.jpg "Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Analysis in human heart muscle and prostate tissues. Corresponding MyBPC3 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC, Single-Cell Western |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QPAFTGSYRCEVSTKDKFDCSNFNLTVHEAMGTGDLDLLSAFRRTSLAGGGRRISDSHEDTGILDFSSLLKKRDSFRTPRDSKLEAPAEEDVWEILRQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYBPC3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Immunohistochemistry_19508.jpg)
![Western Blot MYH7 Antibody (940906) [Unconjugated]](https://images.novusbio.com/images2/MYH7_MAB9096_Western_Blot_19525.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYBPC3 |
![Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human endometrium, heart muscle, pancreas and prostate using Anti-MyBPC3 antibody NBP2-13631 (A) shows similar protein distribution across tissues to independent antibody NBP2-13632 (B).](http://images.novusbio.com/fullsize/MyBPC3-Antibody-Immunohistochemistry-Paraffin-NBP2-13631-img0012.jpg "Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human endometrium, heart muscle, pancreas and prostate using Anti-MyBPC3 antibody NBP2-13631 (A) shows similar protein distribution across tissues to independent antibody NBP2-13632 (B).")
![Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human prostate shows no positivity in smooth muscle cells or glandular cells as expected.](http://images.novusbio.com/fullsize/MyBPC3-Antibody-Immunohistochemistry-Paraffin-NBP2-13631-img0016.jpg "Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human prostate shows no positivity in smooth muscle cells or glandular cells as expected.")
![Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/MyBPC3-Antibody-Immunohistochemistry-NBP2-13631-img0013.jpg "Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/MyBPC3-Antibody-Immunohistochemistry-Paraffin-NBP2-13631-img0014.jpg "Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/MyBPC3-Antibody-Immunohistochemistry-Paraffin-NBP2-13631-img0015.jpg "Immunohistochemistry-Paraffin: MyBPC3 Antibody [NBP2-13631] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Immunocytochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunocytochemistry_15884.jpg)
![Immunohistochemistry Cardiac Troponin T Antibody (200805) [Unconjugated] - (Cardiac)](https://images.novusbio.com/images2/Troponin_T_MAB1874_Immunohistochemistry_17796.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")