![Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/LANCL1-Antibody-Western-Blot-NBP1-81796-img0013.jpg "Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAQRAFPNPYADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | LANCL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Simple_Western_16530.jpg)
![Western Blot GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Western_Blot_13066.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for LANCL1 Antibody (NBP1-81796)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | LANCL1 |
![Immunocytochemistry/Immunofluorescence: LANCL1 Antibody [NBP1-81796] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.](http://images.novusbio.com/fullsize/LANCL1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81796-img0007.jpg "Immunocytochemistry/Immunofluorescence: LANCL1 Antibody [NBP1-81796] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.")
![Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons and neuropil.](http://images.novusbio.com/fullsize/LANCL1-Antibody-Immunohistochemistry-Paraffin-NBP1-81796-img0011.jpg "Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons and neuropil.")
![Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in human cell line SK-BR-3.](http://images.novusbio.com/fullsize/LANCL1-Antibody-Western-Blot-NBP1-81796-img0012.jpg "Western Blot: LANCL1 Antibody [NBP1-81796] - Analysis in human cell line SK-BR-3.")
![Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.](http://images.novusbio.com/fullsize/LANCL1-Antibody-Immunohistochemistry-Paraffin-NBP1-81796-img0008.jpg "Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.")
![Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human kidney shows weak membranous positivity in cells in tubules.](http://images.novusbio.com/fullsize/LANCL1-Antibody-Immunohistochemistry-Paraffin-NBP1-81796-img0009.jpg "Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human kidney shows weak membranous positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/LANCL1-Antibody-Immunohistochemistry-Paraffin-NBP1-81796-img0010.jpg "Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human testis shows moderate membranous positivity in cells in seminiferous ducts.")
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![SDS-PAGE IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_403.jpg)
![Bioactivity IL-12 [Unconjugated]](https://images.novusbio.com/images2/IL-12_419-ML_405.jpg)
![Western Blot Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Western_Blot_5334.jpg)
![Immunohistochemistry Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Immunohistochemistry_10404.jpg)
![Simple Western Annexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Annexin_A1_AF3770_Simple_Western_16649.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![N/A IL-37/IL-1F7 [Biotin]](https://images.novusbio.com/images2/DATA_IL37_DY1975_ELISA_1742.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Intracellular Staining by Flow Cytometry Reg1A Antibody (431202) [Unconjugated]](https://images.novusbio.com/images2/Reg1A_MAB4937_Flow_Cytometry_8512.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")