Home » Isoleucyl tRNA synthetase » Isoleucyl tRNA synthetase Antibodies » Isoleucyl tRNA synthetase Antibody
Novus Biologicals products are now on bio-techne.com

Isoleucyl tRNA synthetase Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Isoleucyl tRNA synthetase Antibody [NBP3-35104] - Western blot analysis of various lysates using Isoleucyl tRNA synthetase Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.
Western Blot: Isoleucyl tRNA synthetase Antibody [NBP3-35104] - Western blot analysis of various lysates using Isoleucyl tRNA synthetase Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Isoleucyl tRNA synthetase Antibody Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1158-1262 of human Isoleucyl tRNA synthetase (NP_002152.2).

Sequence:
SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IARS
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500 - 1:2000
Theoretical MW
144 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Isoleucyl tRNA synthetase Antibody

  • EC 6.1.1
  • EC 6.1.1.5
  • FLJ20736
  • IARS1
  • ILERS
  • ILRS
  • IRS
  • isoleucine tRNA ligase 1, cytoplasmic
  • Isoleucine--tRNA ligase
  • isoleucyl-tRNA synthetase
  • isoleucyl-tRNA synthetase, cytoplasmic
  • PRO0785

Background

Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Two alternatively spliced variants have been isolated that represent alternate 5' UTRs. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

IRS1 Antibody
NB100-82001
Immunohistochemistry-Paraffin IRS1 Antibody
Western Blot IRS1 Antibody
Immunocytochemistry/ Immunofluorescence IRS1 Antibody
(4 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IRS2 Antibody
(676415) [Unconjugate
MAB6347
Western Blot IRS2 Antibody (676415) [Unconjugated]
(2 Publications)
Species: Hu
Applications: WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Insulin Receptor
beta Antibody
NBP2-12793
Immunohistochemistry-Paraffin Insulin Receptor beta Antibody
Immunoprecipitation Insulin Receptor beta Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(224 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
PYK2/FAK2 [p
Tyr402] Antibody (592 ...
MAB6210
Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Glut4 Antibody -
BSA Free
NBP1-49533
Flow (Intracellular) Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
Western Blot Glut4 Antibody - BSA Free
(4 Reviews)
(41 Publications)
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
ARHGEF7 Antibody
NBP1-88650
Western Blot ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Immunohistochemistry-Paraffin ARHGEF7 Antibody
Species: Hu
Applications: IHC, IHC-P, KD, WB
PI 3-Kinase p85
alpha Antibody (A3-D0
NBP2-67058
Flow Cytometry PI 3-Kinase p85 alpha Antibody (A3-D0)
Immunocytochemistry/ Immunofluorescence PI 3-Kinase p85 alpha Antibody (A3-D0)
Immunocytochemistry/ Immunofluorescence PI 3-Kinase p85 alpha Antibody (A3-D0)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MTGR1 Antibody
NBP2-34136
Western Blot MTGR1 Antibody
Immunohistochemistry-Paraffin MTGR1 Antibody
Immunohistochemistry-Paraffin MTGR1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PI 3-Kinase p85
beta Antibody (572001 ...
MAB6777
Western Blot PI 3-Kinase p85 beta Antibody (572001) [Unconjugated]
Immunocytochemistry PI 3-Kinase p85 beta Antibody (572001) [Unconjugated]
(2 Publications)
Species: Hu
Applications: ICC, WB
ASPP1 Antibody
NBP1-90078
Immunohistochemistry-Paraffin ASPP1 Antibody
Western Blot ASPP1 Antibody
Western Blot ASPP1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Publications for Isoleucyl tRNA synthetase Antibody (NBP3-35104) (0)

There are no publications for Isoleucyl tRNA synthetase Antibody (NBP3-35104).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Isoleucyl tRNA synthetase Antibody (NBP3-35104) (0)

There are no reviews for Isoleucyl tRNA synthetase Antibody (NBP3-35104). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Isoleucyl tRNA synthetase Antibody (NBP3-35104) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Isoleucyl tRNA synthetase Products

Research Areas for Isoleucyl tRNA synthetase Antibody (NBP3-35104)

Find related products by research area.

Blogs on Isoleucyl tRNA synthetase

There are no specific blogs for Isoleucyl tRNA synthetase, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Isoleucyl tRNA synthetase Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol IARS