Novus Biologicals products are now on bio-techne.com

Recombinant Human IKK alpha GST (N-Term) Protein

Name: Recombinant Human IKK alpha GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00001147-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

SDS-Page: Recombinant Human IKK alpha Protein [H00001147-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human IKK alpha GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 646-745 of Human IKK alpha Source: Wheat Germ (in vitro) Amino Acid Sequence: RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	CHUK
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array SDS-Page Western Blot
Theoretical MW	36.63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IKK alpha GST (N-Term) Protein

CHUK
conserved helix-loop-helix ubiquitous kinaseIKBKA
EC 2.7.11
EC 2.7.11.10
I-kappa-B kinase 1
I-kappa-B kinase alpha
IkappaB kinase
IkBKA
IkBKalpha
IKK alpha
IKK1
IKK1I-kappa-B kinase-alpha
IKK-A
IKKAIkB kinase alpha subunit
IKK-alphainhibitor of nuclear factor kappa-B kinase subunit alpha
NFKBIKA
NFKBIKAIKK-a kinase
Nuclear factor NFkappaB inhibitor kinase alpha
Nuclear factor NF-kappa-B inhibitor kinase alpha
TCF16
TCF-16
Transcription factor 16

Background

CHUK - conserved helix-loop-helix ubiquitous kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IKK beta Antibody
(10AG2) - BSA Free

NB100-56509

Immunocytochemistry/ Immunofluorescence IKK beta Antibody (10AG2) - BSA Free

(2 Reviews)

(60 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC, IHC-P, IP, Simple Western, WB

IKK epsilon/IKBKE
Antibody (346909) [Un ...

MAB3199

Western Blot IKK epsilon/IKBKE Antibody (346909) [Unconjugated]

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(810 Publications)

Species: Hu

Applications: BA

IkB-alpha Antibody
(6A920) - BSA Free

NB100-56507

Flow Cytometry IkB-alpha Antibody (6A920) - BSA Free

(42 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB

Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...

NBP2-29661

(95 Publications)

Species: Hu, Mu, Rt

Applications: ELISA

IKK gamma
Inhibitor Peptide Set

NBP2-26504

(22 Publications)

Species: Hu, Mu, Rt

Applications: B/N, Func-Inh, In vitro, In vivo

Synaptotagmin 1
Antibody (ASV48) [Unc ...

MAB4364

Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]

(2 Publications)

Species: Rt

Applications: ICC, IHC, IP, KO, WB

WNK1 Antibody
[Unconjugated]

AF2849

(5 Publications)

Species: Mu, Rt

Applications: WB

GRASP65 Antibody
(OTI5G8)

NBP2-02665

Flow Cytometry GRASP65 Antibody (OTI5G8)

(3 Reviews)

(2 Publications)

Species: Ca, Hu, Pm, Po, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

c-jun [p Ser63]
Antibody (1018Y) [Unc ...

MAB8930

Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

AKT [p Ser473]
Antibody [Unconjugate ...

AF887

Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

(49 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

NIK/MAP3K14
Antibody - BSA Free

NBP2-23603

Immunohistochemistry NIK/MAP3K14 Antibody - BSA Free

Western Blot NIK/MAP3K14 Antibody - BSA Free

(1 Publication)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

HGK/MAP4K4
Antibody (4A5)

H00009448-M07

Immunohistochemistry-Paraffin HGK/MAP4K4 Antibody (4A5)

(2 Publications)

Species: Bv, Hu, Pa

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

TRAF-2 Antibody

NB100-56173

Immunohistochemistry-Paraffin TRAF-2 Antibody

(4 Publications)

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

JNK1 Antibody
(228601) [Unconjugate

MAB17761

Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC, WB

IL-6 [HRP]

M6000B

(650 Publications)

Species: Mu

Applications: ELISA

CD40/TNFRSF5
Antibody [Unconjugate

AF632

Western Blot CD40/TNFRSF5 Antibody [Unconjugated]

Simple Western CD40/TNFRSF5 Antibody [Unconjugated]

(7 Publications)

Species: Hu

Applications: AgAct, Simple Western, WB

Recombinant Human
IKK alpha GST (N-Term ...

H00001147-Q01

Species: Hu

Applications: WB, ELISA, MA, PAGE, AP

Publications for IKK alpha Partial Recombinant Protein (H00001147-Q01) (0)

There are no publications for IKK alpha Partial Recombinant Protein (H00001147-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IKK alpha Partial Recombinant Protein (H00001147-Q01) (0)

There are no reviews for IKK alpha Partial Recombinant Protein (H00001147-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IKK alpha Partial Recombinant Protein (H00001147-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IKK alpha Products

Research Areas for IKK alpha Partial Recombinant Protein (H00001147-Q01)

Find related products by research area.

Blogs on IKK alpha.

Check out the latest blog posts on IKK alpha.

IKK alpha says "no" to NFk beta
The nuclear factor kappa B (NFkB) is a ubiquitous transcription factor essential for the activation of immune and inflammatory responses. NFkB activity is inhibited when it is associated with IkB proteins in the cell cytoplasm. IkB proteins are phosph... Read full blog post.

Regulating Immune Response Pathways with IKK beta
IKK beta, also known as IKK2, activates the NFkB complex by phosphorylating the NFkB inhibitor, IkBa. Several transcript variants, some protein-coding and some not, have been found for IKKB. The Nuclear Factor-kappa B (NF-kB) family of transcription f... Read full blog post.

IKK alpha: Roles in Development, B-cell Survival and ESC Differentiation
Inhibitor of nuclear factor kappa-B kinase subunit alpha (IKK1 alpha) is a serine/threonine kinase that forms a complex with IKK beta and NEMO. It plays an essential role in embryonic skin development. Mice with low levels of IKKa show an increase in ... Read full blog post.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human IKK alpha GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

CHUK

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human IKK alpha GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human IKK alpha GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human IKK alpha GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for IKK alpha Partial Recombinant Protein (H00001147-Q01) (0)

Reviews for IKK alpha Partial Recombinant Protein (H00001147-Q01) (0)

Product General Protocols

Video Protocols

FAQs for IKK alpha Partial Recombinant Protein (H00001147-Q01) (0)

Additional IKK alpha Products

Research Areas for IKK alpha Partial Recombinant Protein (H00001147-Q01)

Blogs on IKK alpha.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics