Home » HYPB » HYPB Proteins » HYPB Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HYPB Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HYPB Protein (NBP1-89843PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

HYPB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SETD2.

Source: E. coli

Amino Acid Sequence: NLGMTSPLPYDSLGYNAPHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHAQPLVGHSTEPLSAPPPVPVVPHVAAPVEVSSSQYVA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SETD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89843.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HYPB Recombinant Protein Antigen

  • FLJ22472
  • FLJ23184
  • FLJ45883
  • FLJ46217
  • HIF1
  • HIF-1EC 2.1.1.43
  • HIP-1
  • histone-lysine N-methyltransferase SETD2
  • hSET2
  • huntingtin interacting protein 1
  • Huntingtin yeast partner B
  • Huntingtin-interacting protein 1
  • Huntingtin-interacting protein B
  • HYPBp231HBP
  • KIAA1732SET domain-containing protein 2
  • KMT3AHBP231
  • Lysine N-methyltransferase 3A
  • SET domain containing 2
  • SET2FLJ16420

Background

Huntington's disease (HD), a neurodegenerative disorder characterized by loss of striatal neurons, is caused by an expansion of a polyglutamine tract in the HD protein huntingtin. This gene encodes a protein belonging to a class of huntingtin interacting proteins characterized by WW motifs. This protein is a histone methyltransferase that is specific for lysine-36 of histone H3, and methylation of this residue is associated with active chromatin. This protein also contains a novel transcriptional activation domain and has been found associated with hyperphosphorylated RNA polymerase II. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
(45 Reviews)
(1043 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(684 Publications)
Species: Hu
Applications: ELISA
ARNT/HIF-1 beta
Antibody (H1beta234) ...
NB100-124
Western Blot ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
Western Blot ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
Immunocytochemistry/ Immunofluorescence ARNT/HIF-1 beta Antibody (H1beta234) - BSA Free
(4 Reviews)
(106 Publications)
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(105 Publications)
Species: Mu
Applications: ELISA
Von Hippel Lindau
Antibody (OTI1E1)
NBP2-45411
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Immunohistochemistry Von Hippel Lindau Antibody (OTI1E1)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot Glut1 Antibody - BSA Free
Flow Cytometry Glut1 Antibody - BSA Free
Western Blot Glut1 Antibody - BSA Free
(7 Reviews)
(62 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
TIMP-1 [HRP]
DTM100
N/A TIMP-1 [HRP]
N/A TIMP-1 [HRP]
(97 Publications)
Species: Hu
Applications: ELISA
HIF-2 alpha/EPAS1
Antibody - BSA Free
NB100-122
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Immunohistochemistry HIF-2 alpha/EPAS1 Antibody - BSA Free
Western Blot HIF-2 alpha/EPAS1 Antibody - BSA Free
(37 Reviews)
(826 Publications)
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
EPX Antibody
(rEPO104)
NBP3-07388
Immunohistochemistry-Paraffin EPX Antibody (rEPO104)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(42 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
TOR/mTOR [p
Ser2448] Antibody
NB600-607
Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody
Western Blot TOR/mTOR [p Ser2448] Antibody
Data TOR/mTOR [p Ser2448] Antibody
(2 Reviews)
(9 Publications)
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Carbonic Anhydrase
IX/CA9 Antibody - BSA ...
NB100-417
Flow Cytometry Carbonic Anhydrase IX/CA9 Antibody - BSA Free
Immunoblotting Carbonic Anhydrase IX/CA9 Antibody - BSA Free
Immunoblotting Carbonic Anhydrase IX/CA9 Antibody - BSA Free
(7 Reviews)
(284 Publications)
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
HYPB Recombinant
Protein Antigen
NBP1-89843PEP
HYPB Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for HYPB Protein (NBP1-89843PEP) (0)

There are no publications for HYPB Protein (NBP1-89843PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HYPB Protein (NBP1-89843PEP) (0)

There are no reviews for HYPB Protein (NBP1-89843PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HYPB Protein (NBP1-89843PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HYPB Products

Array NBP1-89843PEP

Blogs on HYPB

There are no specific blogs for HYPB, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
HIF-1 alpha Antibody (H1alpha67)
NB100-105
Expression and correlation of 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF in ccRCC. (A, C & E) Positive nuclear staining to the 3 antibodies: HIF-1 alpha, HIF-2 alpha and HAF, in primary ccRCCs at high magnification (100X). (B, D & F) Heterogenous nuclear staining of 3 antibodies in a tumor at low magnification (20X). (G, H and I). Correlation of 3 antibodies with the Fuhrman grade.Citation: Ambrosetti D, Dufies M, Dadone B, Durand M, Borchiellini D, Amiel J, et al. (2018) The two glycolytic markers GLUT1 and MCT1 correlate with tumor grade and survival in clear-cell renal cell carcinoma. PLoS ONE 13(2): e0193477. https://doi.org/10.1371/journal.pone.0193477
HIF-2 alpha/EPAS1 Antibody - BSA Free
NB100-122

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HYPB Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SETD2