![Western Blot: hnRNP H2 Antibody [NBP1-89817] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Western-Blot-NBP1-89817-img0006.jpg "Western Blot: hnRNP H2 Antibody [NBP1-89817] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HNRNPH2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
| Publication using NBP1-89817 | Applications | Species |
|---|---|---|
| Rappe U, Schlechter T, Aschoff M et al. Nuclear ARVCF Protein Binds Splicing Factors and Contributes to the Regulation of Alternative Splicing. J Biol Chem 2014 May 2 [PMID: 24644279] (IP, WB, ICC/IF, Human) | IP, WB, ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HNRNPH2 |
![Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89817] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Immunohistochemistry-Paraffin-NBP1-89817-img0010.jpg "Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89817] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.")
![Western Blot: hnRNP H2 Antibody [NBP1-89817] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Western-Blot-NBP1-89817-img0005.jpg "Western Blot: hnRNP H2 Antibody [NBP1-89817] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431")
![Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89817] - Staining of human gastrointestinal shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Immunohistochemistry-Paraffin-NBP1-89817-img0007.jpg "Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89817] - Staining of human gastrointestinal shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89817] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Immunohistochemistry-Paraffin-NBP1-89817-img0008.jpg "Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89817] - Staining of human fallopian tube shows moderate nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89817] - Staining of human prostate shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/hnRNP-H2-Antibody-Immunohistochemistry-Paraffin-NBP1-89817-img0009.jpg "Immunohistochemistry-Paraffin: hnRNP H2 Antibody [NBP1-89817] - Staining of human prostate shows moderate nuclear positivity in glandular cells.")
![Simple Western Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/16390.jpg)
![Western Blot Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Western_Blot_12720.jpg)
![Immunocytochemistry Cytokeratin 18 Antibody (810811) [Unconjugated]](https://images.novusbio.com/images2/Cytokeratin_18_MAB7619_Immunocytochemistry_12734.jpg)
![Enzyme Activity alpha-Galactosidase A/GLA [Unconjugated]](https://images.novusbio.com/images2/6146-gh_recombinant-human-alpha-galactosidase-a-gla-protein-cf-enzyme-activity-322023131935.jpg)
![Enzyme Activity alpha-Galactosidase A/GLA [Unconjugated]](https://images.novusbio.com/images2/6146-gh_recombinant-human-alpha-galactosidase-a-gla-protein-cf-enzyme-activity-32202314939.jpg)
![SDS-PAGE alpha-Galactosidase A/GLA [Unconjugated]](https://images.novusbio.com/images2/6146-gh_recombinant-human-alpha-galactosidase-a-gla-protein-cf-sds-page-322023141819.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![Immunohistochemistry BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Immunohistochemistry-NBP1-78295-img0002.jpg)
![Western Blot BTK [p Tyr223] Antibody - BSA Free](https://images.novusbio.com/images/BTK-[p-Tyr223]-Antibody-Western-Blot-NBP1-78295-img0004.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")