![Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining in human kidney and skeletal muscle tissues using NBP1-85437 antibody. Corresponding SHMT1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SHMT1-Antibody-Immunohistochemistry-Paraffin-NBP1-85437-img0014.jpg "Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining in human kidney and skeletal muscle tissues using NBP1-85437 antibody. Corresponding SHMT1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MTMPVNGAHKDADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SHMT1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Western_Blot_5819.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19720.jpg)
![Immunocytochemistry Peroxiredoxin 5 Antibody [Unconjugated]](https://images.novusbio.com/images2/Peroxiredoxin_5_AF5724_Immunocytochemistry__Immunofluorescence_19954.jpg)
| Publication using NBP1-85437 | Applications | Species |
|---|---|---|
| Nilsson LM, Forshell TZ, Rimpi S et al. Mouse genetics suggests cell-context dependency for Myc-regulated metabolic enzymes during tumorigenesis. PLoS Genet 2012 [PMID: 22438825] |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Hua Jiang |
WB | Human | 08/16/2021 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SHMT1 |
![Western Blot: SHMT1 Antibody [NBP1-85437] - Analysis in human kidney tissue.](http://images.novusbio.com/fullsize/SHMT1-Antibody-Western-Blot-NBP1-85437-img0007.jpg "Western Blot: SHMT1 Antibody [NBP1-85437] - Analysis in human kidney tissue.")
![Immunocytochemistry/Immunofluorescence: SHMT1 Antibody [NBP1-85437] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.](http://images.novusbio.com/fullsize/SHMT1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85437-img0009.jpg "Immunocytochemistry/Immunofluorescence: SHMT1 Antibody [NBP1-85437] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & cytosol.")
![Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/SHMT1-Antibody-Immunohistochemistry-Paraffin-NBP1-85437-img0010.jpg "Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/SHMT1-Antibody-Immunohistochemistry-Paraffin-NBP1-85437-img0011.jpg "Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/SHMT1-Antibody-Immunohistochemistry-Paraffin-NBP1-85437-img0012.jpg "Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/SHMT1-Antibody-Immunohistochemistry-Paraffin-NBP1-85437-img0013.jpg "Immunohistochemistry-Paraffin: SHMT1 Antibody [NBP1-85437] - Staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry PTHLH/PTHrP Antibody (677939) [Unconjugated]](https://images.novusbio.com/images2/PTHLH_MAB6734_Immunohistochemistry_10816.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
